Recombinant Escherichia coli O127:H6 UPF0266 membrane protein yobD (yobD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your desired tag type for preferential development.
Synonyms
yobD; E2348C_1944; UPF0266 membrane protein YobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-152
Protein Length
full length protein
Species
Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Target Names
yobD
Target Protein Sequence
MTITDLVLILFIAVLLAFAIYDQFIMPRRNGPTLLAIPLLRRGRIDSVIFVGLIVILIYN SVTNHGALITTWLLSALALMGFYIFWIRVPKIIFKQKGFFFANVWIEYSRIKAMNLSEDG VLVMQLEQRRLLIRVRNIDDLEKVYKLLVSTQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0266 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the UPF0266 membrane protein YobD and what is its significance in E. coli O127:H6?

UPF0266 membrane protein YobD is an uncharacterized protein family member found in Escherichia coli. The "UPF" designation indicates it belongs to an Uncharacterized Protein Family, specifically family 0266. As a membrane protein, YobD is integrated into the bacterial membrane where it likely plays roles in cellular processes that are still being elucidated. In E. coli O127:H6 strains, which are associated with enteropathogenic infections, membrane proteins like YobD may contribute to bacterial survival, capsule formation, or pathogenesis, though specific functions remain under investigation .

What expression systems are recommended for producing recombinant YobD protein?

Baculovirus expression systems have proven effective for YobD production, as indicated by commercial preparations of this protein . When working with membrane proteins like YobD, several expression systems merit consideration:

  • Bacterial systems: While E. coli is often the first choice for recombinant protein expression, membrane proteins present unique challenges requiring careful optimization of growth conditions.

  • Yeast systems: Both Saccharomyces cerevisiae and Pichia pastoris offer advantages for membrane protein expression, including proper protein folding machinery and the ability to perform post-translational modifications .

  • Insect cells: Baculovirus-infected insect cells can produce significant yields of functional membrane proteins and appear particularly suitable for YobD expression .

Each system requires optimization of parameters including promoter selection, growth conditions, and harvesting time to maximize yield of functional protein .

What are the optimal storage conditions for recombinant YobD protein?

Recombinant YobD protein stability depends on proper storage conditions. For liquid formulations, storage at -20°C/-80°C provides approximately 6 months of stability. Lyophilized preparations demonstrate extended stability of up to 12 months at -20°C/-80°C .

For working with the protein:

  • Centrifuge vials briefly before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (standard recommendation is 50%)

  • Aliquot for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

  • Working aliquots may be maintained at 4°C for up to one week

How does the culture condition affect the yield and quality of recombinant YobD protein?

Culture conditions significantly impact both yield and quality of membrane proteins like YobD. Contrary to conventional wisdom, the most rapid growth conditions typically do not yield optimal production of membrane proteins .

Critical factors affecting membrane protein production include:

  • Growth phase at harvest: Cells should be harvested prior to glucose exhaustion, just before the diauxic shift. This timing is crucial as it affects membrane protein incorporation and folding efficiency .

  • Temperature: Lower temperatures (typically 25-30°C rather than 37°C) often improve membrane protein folding and reduce formation of inclusion bodies.

  • pH: Controlling pH (typically around 5.0 for yeast systems) helps maintain consistent membrane protein production throughout the growth cycle .

  • Induction timing: For inducible expression systems, induction at appropriate cell density is crucial for optimizing yield while minimizing cellular stress.

Table 1: Impact of Culture Conditions on Membrane Protein Production

ParameterConventional GrowthOptimized for Membrane ProteinsImpact on Yield
Temperature37°C25-30°CModerate to high
Harvest timingStationary phasePre-diauxic shiftHigh
Growth rateMaximizedControlled slower growthHigh
pHUncontrolledControlled (pH 5.0)Moderate
Induction strengthHighModerately lowHigh

These findings emphasize that maximizing cell biomass does not necessarily correspond to maximizing membrane protein yield .

What structural features characterize YobD, and how might they inform functional studies?

While specific structural data for YobD remains limited, analysis of related membrane proteins like GfcD from E. coli O127 provides insights into potential structural features. Membrane proteins in these families often exhibit:

  • β-barrel structures: Many outer membrane proteins form β-barrel structures, like the 26 β-strand configuration observed in GfcD .

  • Internal globular domains: These domains often mediate specific functions within the membrane environment or interact with other cellular components .

  • Protein-protein interaction interfaces: Functional membrane protein complexes rely on specific interaction interfaces, as demonstrated by the interactions between GfcB, GfcC, and GfcD proteins .

Researchers investigating YobD structure should consider employing circular dichroism spectroscopy, light-scattering analysis, and computational prediction tools like HHomp server to characterize secondary structure elements and oligomeric state .

What methodological approaches can resolve contradictions in experimental data regarding YobD function?

When facing contradictory experimental results regarding YobD function, researchers should implement systematic approaches to reconcile disparate findings:

  • Standardize expression and purification protocols: Variations in protein preparation can significantly impact functional assays. Standardizing these protocols across experiments reduces variability.

  • Quantitative biophysical characterization: Employ multiple biophysical techniques (isothermal calorimetry, biolayer interferometry) to quantify binding properties and protein-protein interactions with consistent parameters .

  • In vivo and in vitro validation: Verify interactions and functions both in cellular contexts and with purified components to distinguish between direct and indirect effects .

  • Consider strain-specific variations: Different E. coli strains may exhibit variations in YobD sequence or regulation that could explain functional differences.

  • Design controlled experiments: Implement factorial experimental designs to systematically evaluate the impact of multiple variables simultaneously .

What are the critical factors in designing expression systems for high-yield production of functional YobD?

Designing effective expression systems for YobD requires careful consideration of multiple factors:

  • Vector selection: Choose vectors with appropriate promoters, fusion tags, and regulatory elements optimized for membrane protein expression.

  • Host strain selection: Consider specialized strains developed for membrane protein expression that may contain mutations affecting membrane composition or protein folding machinery.

  • Growth regime optimization: Implement tightly-controlled bioreactor conditions rather than shake flask cultivation to maintain consistent parameters including:

    • Dissolved oxygen concentration

    • pH

    • Temperature

    • Nutrient availability

  • Harvest timing optimization: Develop protocols for harvesting cells at precise growth phases, monitoring glucose consumption to identify the pre-diauxic shift window for optimal yields .

  • Tag position and type: Test both N-terminal and C-terminal tags, as improper tag placement can disrupt membrane insertion or protein folding.

How can researchers effectively validate the correct folding and membrane integration of recombinant YobD?

Validating proper folding and membrane integration requires multiple complementary approaches:

  • Membrane fractionation: Perform cellular fractionation to confirm localization of YobD to membrane fractions rather than inclusion bodies or cytosolic fractions .

  • Protease protection assays: Determine membrane topology by assessing protease accessibility of specific domains in the presence or absence of membrane permeabilization.

  • Functional assays: Develop assays that assess specific activities or binding partners to confirm functional integrity.

  • Biophysical characterization: Apply techniques such as circular dichroism to assess secondary structure content and thermal stability of the purified protein .

  • Mass spectrometry: Confirm post-translational modifications and protein integrity through mass spectrometric analysis.

Table 2: Methods for Validating Membrane Protein Folding and Integration

Validation MethodInformation ProvidedTechnical Complexity
Membrane fractionationSubcellular localizationLow
Protease protectionMembrane topologyMedium
Circular dichroismSecondary structure contentMedium
Thermal shift assaysProtein stabilityMedium
Binding partner interactionsFunctional validationHigh
Mass spectrometryProtein integrityHigh

What strategies can resolve poor expression or inclusion body formation when producing YobD?

When facing poor expression or inclusion body formation with YobD:

  • Reduce expression rate: Lower induction levels and expression temperatures to slow protein production and allow proper membrane insertion .

  • Optimize harvest timing: Harvest cells before glucose depletion to prevent stress responses that affect protein folding machinery .

  • Consider fusion partners: Test solubility-enhancing fusion partners specifically developed for membrane proteins.

  • Evaluate detergent screening: For extraction and purification, systematically screen detergents to identify those that maintain YobD in a properly folded state.

  • Co-express chaperones: Co-express molecular chaperones that specifically assist membrane protein folding.

  • Modify culture medium: Supplement growth media with specific compounds that may stabilize the membrane or assist protein folding.

How can researchers address heterogeneity in purified YobD preparations?

Heterogeneity in purified membrane protein preparations is a common challenge that can compromise structural and functional studies. To address this issue:

  • Optimize detergent selection: Test multiple detergents individually and in combination to identify formulations that maintain protein homogeneity.

  • Implement multi-step purification: Develop purification strategies combining:

    • Affinity chromatography

    • Ion exchange chromatography

    • Size exclusion chromatography

  • Apply thermal stability screening: Identify buffer conditions that maximize thermal stability, which often correlates with sample homogeneity.

  • Consider native nanodiscs or amphipols: These systems can provide a more native-like environment than detergents alone, potentially reducing heterogeneity.

  • Validate with analytical ultracentrifugation: Confirm sample homogeneity through analytical ultracentrifugation or multi-angle light scattering .

What are the promising approaches for determining the physiological function of YobD in E. coli O127:H6?

To elucidate the physiological function of YobD:

  • Comparative genomics: Analyze the genomic context of yobD across different E. coli strains and related species to identify conserved patterns or co-occurrence with functionally characterized genes.

  • Knockout/knockdown studies: Generate yobD deletion mutants and assess phenotypic changes under various growth and stress conditions.

  • Protein interaction network mapping: Implement techniques such as bacterial two-hybrid systems, co-immunoprecipitation, or proximity labeling to identify interaction partners .

  • Transcriptomic analysis: Compare gene expression profiles between wild-type and yobD mutant strains to identify affected pathways.

  • In vivo localization studies: Use fluorescent protein fusions or immunolocalization to determine the precise subcellular localization of YobD under different conditions.

  • Structural studies: Pursue high-resolution structural determination through X-ray crystallography or cryo-electron microscopy to provide insights into potential functions.

How might systems biology approaches enhance our understanding of YobD in bacterial membrane biology?

Systems biology approaches offer powerful frameworks for integrating diverse data types to understand YobD function in the broader context of bacterial membrane biology:

  • Multi-omics integration: Combine transcriptomics, proteomics, and metabolomics data to understand how YobD influences cellular processes across different levels of organization.

  • Network analysis: Map YobD into protein-protein interaction networks to identify functional modules and potential roles in cellular pathways.

  • Mathematical modeling: Develop computational models of membrane processes that incorporate YobD to generate testable hypotheses about its function.

  • Evolutionary analysis: Apply comparative genomics across bacterial species to understand the evolution and conservation of YobD and related proteins.

  • High-throughput phenotyping: Use automated systems to characterize yobD mutant phenotypes across hundreds of growth conditions to identify specific functional roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.