Recombinant Escherichia coli O127:H6 UPF0283 membrane protein ycjF (ycjF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.

Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted upon request.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

Tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.

Synonyms
ycjF; E2348C_1515; UPF0283 membrane protein YcjF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Target Names
ycjF
Target Protein Sequence
MTEPLKPRIDFDGPLDVDQNPKFRAQQTFDENQAQNFAPATLDEAPEEEGQVEAVMDAAL RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVV TEWRRLWRLRQRAHERDEARDLLHSHGTGKGRAFCEKLAQQAGIDQSHPALQRWYASIHE TQNDREVVSLYAHLVQPVLDAQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFKLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWIDDDKPRLGDFRRQLIGQVKETLQKGKTPSEK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is YcjF protein related to other gene products in the ycj cluster?

The ycjF gene is part of a 12-gene cluster (ycjM-W plus ompG) identified in E. coli K-12 that is believed to function as a potential catabolic pathway. Within this cluster, other characterized proteins include YcjQ and YcjS, which have been cloned, expressed, and purified for functional studies .

The relationship between YcjF and other proteins in this cluster can be studied through:

  • Gene proximity analysis on the chromosome

  • Co-expression patterns under various growth conditions

  • Protein-protein interaction studies

  • Functional complementation experiments

Research suggests that genes within the same operon often participate in related biological processes, making the study of the entire ycj cluster valuable for understanding YcjF's role .

What are the recommended storage conditions for recombinant YcjF protein?

For optimal stability of recombinant YcjF protein, researchers should follow these storage guidelines:

Storage ConditionRecommendationDuration
Long-term storage-20°C to -80°CUp to 12 months (lyophilized), 6 months (liquid)
Working aliquots4°CUp to one week
Buffer compositionTris/PBS-based buffer, 6% Trehalose, pH 8.0-
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)-
Preservative5-50% glycerol (final concentration)-

Important handling notes:

  • Repeated freeze-thaw cycles should be avoided to prevent protein degradation

  • Briefly centrifuge vials prior to opening to bring contents to the bottom

  • Aliquot reconstituted protein for single use to minimize freeze-thaw cycles

What are the optimal expression systems and conditions for producing recombinant YcjF protein?

Based on established protocols, the following expression system and conditions are recommended for optimal production of recombinant YcjF:

Expression System:

  • Host: E. coli BL-21 (DE3) cells

  • Vector: pET-based expression vector (e.g., pET-30a(+))

  • Tag configuration: N-terminal His6-tag for purification

Expression Conditions:

  • Transform expression plasmid into BL-21 (DE3) cells

  • Culture in LB medium supplemented with appropriate antibiotic (e.g., 50 μg/mL kanamycin)

  • Grow cultures at 37°C with shaking at 150 rpm until OD600 reaches ~0.6

  • Induce protein expression with IPTG (final concentration 0.5 mM)

  • Allow cultures to grow overnight at 25°C (lowered temperature improves protein folding)

  • Harvest cells by centrifugation at 11,000 g for 12-15 minutes

  • Store cell pellet at -80°C until protein purification

This methodology has been successfully applied to related proteins in the ycj cluster such as YcjQ and YcjS, and should be adaptable to YcjF expression with minor modifications .

What purification strategies are most effective for isolating high-quality YcjF protein?

For purifying His-tagged YcjF protein to high homogeneity, the following methodology is recommended:

Purification Protocol:

  • Cell Lysis:

    • Resuspend frozen cell pellet in lysis buffer (typically 50 mM HEPES/K+ at pH 7.5, 100 mM NaCl, 5% glycerol)

    • Add protease inhibitors to prevent degradation

    • Lyse cells via sonication or high-pressure homogenization

  • Initial Clarification:

    • Centrifuge lysate at high speed (e.g., 20,000 g for 30 minutes at 4°C)

    • Collect supernatant containing soluble proteins

  • Affinity Chromatography:

    • Load clarified lysate onto Ni-NTA or similar metal affinity resin

    • Wash with buffer containing low imidazole concentration (10-20 mM) to remove non-specific binding

    • Elute His-tagged YcjF with buffer containing higher imidazole concentration (250-300 mM)

  • Further Purification (if needed):

    • Size exclusion chromatography to remove aggregates and achieve higher purity

    • Ion exchange chromatography to separate based on charge properties

  • Quality Control:

    • Assess purity by SDS-PAGE (>90% purity is typically achievable)

    • Verify protein identity by Western blotting or mass spectrometry

    • Test activity using appropriate functional assays

This purification strategy has yielded high-purity preparations of related membrane proteins and should be effective for YcjF .

How can researchers verify the structural integrity of purified YcjF protein?

Multiple complementary techniques should be employed to verify the structural integrity of purified YcjF:

  • SDS-PAGE and Western Blotting:

    • Confirm correct molecular weight (approximately 38-40 kDa including His-tag)

    • Verify immunoreactivity with anti-His antibodies or specific anti-YcjF antibodies

  • Mass Spectrometry:

    • Peptide mass fingerprinting to confirm protein identity

    • Intact mass analysis to verify full-length expression

  • Circular Dichroism (CD) Spectroscopy:

    • Assess secondary structure content

    • Monitor thermal stability through temperature-dependent unfolding

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS):

    • Determine oligomeric state in solution

    • Detect presence of aggregates

  • Limited Proteolysis:

    • Probe for well-folded domains resistant to proteolytic degradation

    • Compare digestion patterns with native and denatured protein

  • Functional Assays:

    • Though specific function is unknown, potential membrane-binding assays

    • Protein-protein interaction studies with other Ycj cluster proteins

These techniques together provide a comprehensive assessment of protein quality and structural integrity, essential for downstream functional studies .

What approaches can be used to elucidate the biological function of YcjF?

Given that YcjF is classified as an uncharacterized protein (UPF0283), multiple complementary approaches are recommended to determine its biological function:

  • Comparative Genomics Approaches:

    • Analyze genomic context - YcjF is part of a 12-gene cluster (ycjM-W and ompG) likely functioning as a catabolic pathway

    • Perform phylogenetic profiling to identify co-evolved proteins

    • Examine conservation patterns across bacterial species

  • Transcriptomic Analysis:

    • Conduct RNA-Seq under various growth conditions to identify co-regulated genes

    • Analyze differential expression in response to specific stressors or nutrients

    • Examine expression in biofilm formation conditions, as E. coli K-12 biofilm formation has been studied with gene expression profiling

  • Genetic Approaches:

    • Generate knockout mutants and characterize phenotypes

    • Perform complementation studies

    • Construct conditional expression systems for essential genes

  • Biochemical and Structural Characterization:

    • Determine membrane topology using reporter fusions or protease accessibility assays

    • Perform protein-protein interaction studies (pull-downs, crosslinking)

    • Solve protein structure using X-ray crystallography or cryo-EM

    • Conduct ligand binding assays with potential metabolites

  • Systems Biology Approaches:

    • Metabolomic profiling of wildtype vs. ycjF mutants

    • Flux analysis to identify altered metabolic pathways

    • Integration of multi-omics data to predict function

These approaches should be applied in parallel, as converging evidence from multiple methods provides stronger functional assignments .

How does the expression of recombinant YcjF affect host cell physiology, and how can these effects be mitigated?

Expression of membrane proteins like YcjF can significantly impact host cell physiology, potentially limiting yields and quality. Research suggests several key considerations:

Effects on Host Cell Physiology:

  • Membrane stress: Overexpression of membrane proteins can disrupt membrane integrity

  • Protein folding burden: May overwhelm the host cell's folding machinery

  • Metabolic burden: Diverts resources from essential cellular processes

  • Toxicity: Potential interference with host cell membrane proteins

  • Secretory pathway strain: High expression can overload transport mechanisms

Mitigation Strategies Based on Research Findings:

  • Optimize expression conditions:

    • Use lower growth temperatures (25°C instead of 37°C) to improve folding

    • Employ weaker promoters or inducible systems with tunable expression levels

    • Optimize codon usage for the host organism

  • Select appropriate host strains:

    • Use specialized strains engineered for membrane protein expression

    • Consider strains with enhanced folding capacity (e.g., containing additional chaperones)

  • Co-expression strategies:

    • Co-express molecular chaperones to aid folding

    • Co-express rare tRNAs for problematic codons

  • Process optimization:

    • Implement fed-batch cultivation to control growth rate

    • Optimize media composition to support membrane protein synthesis

Recent research has demonstrated that protein-specific features explain only about 15% of the variability in recombinant protein yield, suggesting that host cell factors and expression conditions play dominant roles in successful production .

What structural and functional relationships exist between YcjF and homologous proteins in other bacterial species?

Investigation of YcjF homologs across bacterial species reveals important evolutionary and functional insights:

Structural Conservation:
YcjF belongs to the UPF0283 family of membrane proteins, which shares several conserved features across bacterial species:

  • Multiple transmembrane domains with a characteristic topology

  • Conserved motifs in cytoplasmic loops that may be involved in ligand binding or protein-protein interactions

  • A predicted N-terminal cytoplasmic domain that shows higher sequence variability

Taxonomic Distribution:
The ycjF gene and its homologs are widely distributed across Enterobacteriaceae but show varied conservation patterns:

Bacterial GroupYcjF Homolog PresentGene Context Conservation
E. coli and ShigellaHigh identity (>90%)Conserved gene cluster
Other EnterobacteriaceaeModerate identity (60-85%)Partial conservation
Other ProteobacteriaLower identity (<60%)Different genomic context

Functional Implications:
While the specific function remains uncharacterized, comparative analysis suggests:

  • Association with catabolic pathways based on genomic context

  • Potential roles in membrane transport or sensing

  • Possible involvement in stress responses or adaptation to specific environmental conditions

Interestingly, in E. coli O127:H6 (strain E2348/69, an EPEC strain), YcjF is part of the core genome rather than within prophage regions or other mobile genetic elements, suggesting an important cellular function rather than a virulence-associated role .

Advanced structural prediction methods combined with experimental validation will be required to fully understand the structure-function relationships of this protein family.

What are the best techniques for analyzing YcjF membrane topology and integration?

As YcjF is a membrane protein, determining its topology is critical for functional studies. Multiple complementary techniques should be employed:

Computational Prediction Approaches:

  • Hydropathy analysis: Tools like TMHMM, Phobius, or TOPCONS to predict transmembrane segments

  • Consensus topology modeling: Combining results from multiple algorithms for increased confidence

  • Evolutionary analysis: Conservation patterns often correlate with functional importance

Experimental Validation Methods:

  • Fusion Reporter Techniques:

    • PhoA (alkaline phosphatase) fusion: Active only when located in periplasm

    • GFP fusion: Fluorescent only when located in cytoplasm

    • Dual reporter systems for increased confidence

  • Protein Modification Approaches:

    • Cysteine scanning mutagenesis followed by accessibility studies

    • Site-directed fluorescence labeling at predicted loop regions

    • Limited proteolysis of membrane preparations

  • Advanced Biophysical Methods:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling

    • Cryo-electron microscopy of membrane-embedded protein

  • Cross-linking Studies:

    • Chemical crosslinking of accessible residues

    • Photo-crosslinking with unnatural amino acids

By combining these approaches, researchers can develop a robust model of YcjF membrane topology, which is essential for understanding its function and interactions with other cellular components .

How can differential expression analysis be used to understand YcjF function in various growth conditions?

Differential expression analysis provides valuable insights into YcjF function by examining its expression patterns across various conditions:

Experimental Design for Differential Expression Studies:

  • Condition Selection:

    • Standard vs. stress conditions (pH, temperature, osmotic pressure)

    • Various carbon sources to test catabolic pathway involvement

    • Biofilm vs. planktonic growth stages

    • Exposure to antimicrobial compounds

  • RNA Extraction and Analysis Methods:

    • RNA-Seq for genome-wide expression profiling

    • qRT-PCR for targeted expression analysis of ycjF and related genes

    • Microarray analysis (as demonstrated in studies of E. coli gene expression with ursolic acid)

  • Data Analysis Workflow:

    • Normalization methods appropriate for bacterial transcriptomics

    • Statistical approaches for identifying significant expression changes

    • Clustering analysis to identify co-regulated genes

    • Network analysis to infer functional relationships

Case Study Application:
Previous research has shown that DNA microarrays can effectively study gene expression profiles of E. coli K-12 under different conditions (e.g., with or without ursolic acid). Similar approaches could be applied to understand YcjF expression:

  • Grow E. coli samples with and without specific treatments

  • Extract and convert RNA to labeled cDNA

  • Perform dye-swap experiments to eliminate artifacts (Cy3/Cy5 labeling)

  • Analyze expression patterns across multiple replicates

  • Identify conditions that significantly alter ycjF expression

This approach helps identify conditions where YcjF is particularly important, providing clues to its biological function and regulatory networks.

What are the challenges and solutions in producing sufficient quantities of functional YcjF for structural studies?

Producing membrane proteins like YcjF in quantities sufficient for structural studies presents several challenges that require specialized approaches:

Major Challenges:

  • Low expression levels: Membrane proteins typically express at lower levels than soluble proteins

  • Protein misfolding: Improper folding in heterologous expression systems

  • Aggregation: Tendency to form inclusion bodies or aggregates

  • Toxicity to host cells: Disruption of host membranes

  • Detergent compatibility: Finding detergents that maintain native structure during purification

Solutions and Strategies:

  • Expression System Optimization:

    SystemAdvantagesConsiderations
    E. coliFast growth, high yields, low costMay not handle complex membrane proteins well
    Yeast (P. pastoris)Eukaryotic processing, higher yieldsLonger process time, more complex media
    Insect cells (Baculovirus)Good for complex proteinsHigher cost, longer production time
    Cell-free systemsAvoids toxicity issuesLower yields, higher cost
  • Protein Engineering Approaches:

    • Fusion to solubilizing partners (MBP, SUMO, Mistic)

    • Truncation to remove flexible regions

    • Surface engineering to improve stability

    • Directed evolution for improved expression

  • Purification Refinements:

    • Systematic detergent screening

    • Bicelle or nanodisc reconstitution

    • Lipid supplementation during purification

    • Stabilizing ligands or binding partners

  • Scale-up Strategies:

    • High-density fermentation

    • Fed-batch cultivation with controlled feeding

    • Process monitoring to maintain optimal conditions

How can researchers distinguish between functional and non-functional forms of recombinant YcjF?

Without a defined functional assay for YcjF, researchers must rely on multiple indicators to assess whether the recombinant protein is correctly folded and potentially functional:

Biophysical Characterization:

  • Thermal stability assays: Well-folded proteins typically show cooperative unfolding transitions

  • Circular dichroism: Compare secondary structure content with predictions

  • Intrinsic fluorescence: Monitor tryptophan environments as indicators of folding

  • Size exclusion chromatography: Assess monodispersity and appropriate oligomeric state

Membrane Integration Analysis:

  • Detergent binding properties: Properly folded membrane proteins bind detergent micelles consistently

  • Lipid binding assays: Assess interaction with native-like lipid environments

  • Reconstitution efficiency: Successful incorporation into liposomes or nanodiscs

  • Proteoliposome integrity: Measure leakage rates as indicators of proper membrane protein function

Functional Surrogate Assays:

  • Ligand binding: Screen for binding to metabolites related to the putative catabolic pathway

  • Protein-protein interactions: Test interaction with other members of the ycj gene cluster

  • Complementation studies: Ability to rescue phenotypes in ycjF knockout strains

  • Electrophysiology: If YcjF functions as a channel or transporter, measure conductance in reconstituted systems

Comparative Analysis:
Compare properties of recombinant YcjF from different expression systems to identify consistent characteristics that likely represent the native state versus expression artifacts .

What bioinformatic approaches can predict potential interacting partners or substrates for YcjF?

Several bioinformatic approaches can provide insights into potential YcjF interactions and functions:

Genomic Context Analysis:

  • Operonic structure examination: YcjF is part of a 12-gene cluster (ycjM-W and ompG) likely functioning as a catabolic pathway

  • Conserved gene neighborhoods: Compare genomic context across bacterial species

  • Phylogenetic profiling: Identify genes with similar evolutionary presence/absence patterns

Protein Sequence Analysis:

  • Motif identification: Search for binding motifs or functional domains

  • Conservation mapping: Highly conserved surface residues often indicate functional sites

  • Coevolution analysis: Identify residues that coevolve with residues in potential partner proteins

Structural Bioinformatics:

  • Homology modeling: Generate 3D models based on related proteins

  • Molecular docking: Virtual screening of potential metabolites or protein partners

  • Binding pocket analysis: Identify potential active sites or binding pockets

Network-Based Approaches:

  • Functional association networks: Tools like STRING database to predict functional associations

  • Expression correlation analysis: Identify genes with similar expression patterns

  • Metabolic network integration: Position YcjF in the context of E. coli metabolic pathways

Machine Learning Applications:

  • Function prediction algorithms: Tools like DeepFRI or GOLabeler

  • Interaction prediction: Machine learning models trained on known protein-protein interactions

  • Substrate specificity prediction: Models trained on enzyme-substrate relationships

The integration of these approaches, coupled with experimental validation, provides a robust strategy for generating testable hypotheses about YcjF function .

How can researchers evaluate the impact of specific mutations on YcjF structure and function?

A comprehensive mutational analysis strategy is essential for understanding structure-function relationships in YcjF:

Mutation Design Strategy:

  • Conservation-based targeting:

    • Mutate highly conserved residues across homologs

    • Focus on residues conserved in specific bacterial clades

  • Structure-based targeting:

    • Target predicted transmembrane helices vs. loop regions

    • Focus on predicted binding pockets or interfaces

    • Disrupt potential membrane-interaction motifs

  • Systematic scanning:

    • Alanine scanning of specific regions

    • Cysteine scanning for accessibility studies

    • Charged residue scanning in transmembrane segments

Functional Impact Assessment:

  • In vivo approaches:

    • Complementation of ycjF knockout strains

    • Growth phenotype analysis under various conditions

    • Stress response and survival assays

  • Biochemical characterization:

    • Expression and folding efficiency

    • Membrane integration assessment

    • Stability measurements (thermal, chemical denaturation)

    • Oligomerization state analysis

  • Advanced biophysical methods:

    • HDX-MS to detect conformational changes

    • NMR for local structural perturbations

    • Single-molecule FRET for dynamics assessment

Data Analysis Framework:

  • Structure-function correlation:

    • Map mutational effects onto structural models

    • Identify clusters of functionally important residues

    • Correlate conservation with functional importance

  • Network analysis:

    • Generate residue interaction networks

    • Identify allosteric pathways

    • Predict compensatory mutations

  • Machine learning applications:

    • Train predictive models of mutation effects

    • Identify patterns in mutational outcomes

    • Guide next-generation mutation design

This systematic approach allows researchers to build a comprehensive understanding of YcjF's structure-function relationship, even without prior knowledge of its specific biological role .

What are the most promising future research directions for understanding YcjF function?

Based on current knowledge and methodological capabilities, the following research directions hold the greatest promise for elucidating YcjF function:

  • Systems Biology Integration:

    • Multi-omics profiling (transcriptomics, proteomics, metabolomics) of ycjF mutants

    • Network reconstruction to position YcjF in cellular pathways

    • Flux balance analysis to identify metabolic perturbations

  • High-Resolution Structural Studies:

    • Cryo-EM analysis of YcjF in membrane environments

    • Structure determination in complex with potential binding partners

    • Molecular dynamics simulations to understand conformational flexibility

  • Comprehensive Genetic Analysis:

    • Genome-wide synthetic genetic arrays with ycjF mutants

    • Suppressor screens to identify functional relationships

    • CRISPR interference screens under different growth conditions

  • Evolutionary Perspectives:

    • Comparative analysis across diverse bacterial species

    • Reconstruction of ancestral sequences and functional testing

    • Correlation of YcjF variants with bacterial adaptation to specific niches

  • Development of YcjF-Specific Tools:

    • Specific antibodies or nanobodies for localization studies

    • Chemical probes to detect YcjF activity

    • Biosensors based on YcjF for detecting relevant metabolites

The integration of these approaches, with particular emphasis on linking molecular-level insights to cellular and ecological functions, represents the most promising path forward in understanding this uncharacterized membrane protein .

How might understanding YcjF function contribute to broader knowledge in bacterial physiology?

Elucidating YcjF function has potential to impact multiple areas of bacterial biology:

  • Metabolic Network Understanding:

    • YcjF is part of a predicted catabolic pathway, and characterizing its function would fill a gap in our understanding of E. coli metabolism

    • May reveal novel metabolic capabilities or regulatory mechanisms

  • Membrane Biology Insights:

    • As a membrane protein of unknown function, YcjF characterization could reveal novel membrane-associated processes

    • May contribute to understanding membrane organization and dynamics

  • Bacterial Adaptation Mechanisms:

    • The conservation of YcjF across many bacterial species suggests an important role

    • Understanding its function may reveal how bacteria adapt to specific environmental niches

  • Evolution of Protein Function:

    • As an uncharacterized protein family (UPF0283), functional characterization would contribute to understanding how novel protein functions evolve

    • May reveal evolutionary relationships between different membrane protein families

  • Applied Biotechnology Potential:

    • Knowledge of YcjF function could lead to applications in metabolic engineering

    • May provide targets for antimicrobial development if found to be essential in certain conditions

  • Model System for Membrane Protein Studies:

    • YcjF could serve as a model system for studying challenging aspects of membrane protein expression, purification, and characterization

    • Methodological advances could benefit the broader field of membrane protein research

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.