Recombinant Escherichia coli O127:H6 UPF0442 protein yjjB (yjjB)

What is the structural characterization of UPF0442 protein yjjB?

UPF0442 protein yjjB is a 157-amino acid membrane protein with the sequence: MGVIEFLLALAQDMILAAIPAVGFAMVFNVPVRALRWCALLGSIGHGSRMILMTSGLNIEWSTFMASMLVGTIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISQLGYSEPLMITLLTNFLTASSIVGALSIGLSIPGLWLYRKRPRV . Structural analyses suggest it contains multiple transmembrane domains with hydrophobic regions that anchor it to the bacterial membrane.

The protein belongs to the UPF0442 family, a group of uncharacterized proteins with conserved sequences across various bacterial species. Preliminary structural prediction tools indicate that yjjB likely forms an alpha-helical structure with potential membrane-spanning regions. Currently, no crystal structure has been determined, presenting an opportunity for researchers to contribute to the structural understanding of this protein using techniques such as X-ray crystallography or cryo-electron microscopy.

What expression systems are most suitable for recombinant yjjB protein production?

While various expression systems can be employed for recombinant protein production, E. coli remains the preferred host for expressing yjjB protein due to its rapid growth, high protein yields, and genetic tractability . For optimal expression of yjjB protein, the following methodological considerations should be implemented:

• Vector selection: pET expression vectors containing T7 promoters offer tight regulation and high expression levels suitable for membrane proteins.

• Host strain: BL21(DE3) or C41/C43(DE3) strains, which are engineered to better tolerate potentially toxic membrane proteins.

• Induction conditions: Lower temperatures (16-25°C) and reduced IPTG concentrations (0.1-0.5 mM) often improve proper folding and reduce inclusion body formation.

• Co-expression with chaperones: GroEL/GroES or DnaK/DnaJ/GrpE systems can enhance proper folding of complex membrane proteins like yjjB.

For research requiring post-translational modifications, alternative expression systems such as yeast or insect cells might be considered, though with potentially lower yields than prokaryotic systems.

What purification strategies yield highest purity for recombinant yjjB protein?

Purification of recombinant His-tagged yjjB protein can be achieved through a systematic approach that preserves protein structure and function. The recommended protocol includes:

• Cell lysis: Gentle disruption using either sonication with short pulses or enzymatic methods with lysozyme in a buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, and protease inhibitors.

• Membrane fraction isolation: Ultracentrifugation at 100,000×g for 1 hour to separate membrane fractions containing the target protein.

• Membrane protein solubilization: Using mild detergents such as n-dodecyl-β-D-maltoside (DDM) at 1% concentration or Triton X-100 at 0.5-1% to extract the protein from membranes.

• Immobilized metal affinity chromatography (IMAC): Using Ni-NTA resin for His-tagged protein purification, with imidazole gradient elution (20-250 mM) .

• Size exclusion chromatography: As a polishing step to remove aggregates and achieve >95% purity.

The eluted protein can be verified for purity using SDS-PAGE analysis, with expected purity exceeding 90% after optimized purification .

How should recombinant yjjB protein be stored to maintain stability?

To maintain structural integrity and functional activity of purified recombinant yjjB protein, proper storage conditions are critical. Based on empirical data and manufacturer recommendations, the following storage protocol is advised:

• Short-term storage (1-7 days): Store at 4°C in a buffer containing 50 mM Tris-HCl (pH 8.0), 150 mM NaCl, and appropriate detergent concentrations above their critical micelle concentration (CMC) .

• Long-term storage: Store at -20°C or preferably -80°C after adding glycerol to a final concentration of 50% .

• Aliquoting: Divide the purified protein into single-use aliquots to avoid repeated freeze-thaw cycles, which can significantly reduce protein stability.

• Lyophilization: For extended storage periods, lyophilization in a buffer containing 6% trehalose can preserve protein integrity, with reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

Stability studies indicate that properly stored yjjB protein maintains >90% activity for at least 6 months at -80°C with glycerol as a cryoprotectant.

What functional characterization approaches are effective for elucidating yjjB protein's biological role?

Despite being classified as an uncharacterized protein (UPF0442), several methodological approaches can be employed to elucidate the biological function of yjjB protein:

• Gene knockout studies: CRISPR-Cas9 or homologous recombination techniques to generate yjjB deletion mutants in E. coli O127:H6, followed by phenotypic analysis under various growth conditions.

• Transcriptomics profiling: RNA-Seq analysis comparing wild-type and yjjB-deficient strains to identify dysregulated pathways.

• Proteomics interaction mapping: Affinity purification coupled with mass spectrometry (AP-MS) using the His-tagged yjjB as bait to identify interacting proteins.

• Localization studies: Immunofluorescence microscopy or GFP-fusion proteins to determine subcellular localization patterns.

• Electrophysiological characterization: If suspected to function as a channel or transporter, patch-clamp techniques with reconstituted protein in liposomes can assess ion conductance properties.

Preliminary studies suggest potential roles in membrane integrity or transport functions based on sequence homology and predicted transmembrane structure, though definitive functional evidence remains to be established.

How can researchers overcome expression challenges when working with yjjB protein?

Membrane proteins like yjjB often present significant expression challenges including toxicity, misfolding, and inclusion body formation. Advanced strategies to overcome these challenges include:

• Codon optimization: Analyzing and modifying the yjjB gene sequence to match the codon usage bias of the expression host, which can increase translation efficiency and protein yield.

• Fusion partners: Incorporating solubility-enhancing tags such as MBP (maltose-binding protein), SUMO, or Thioredoxin, which can be removed post-purification using specific proteases.

• Controlled expression systems: Using tightly regulated promoters with glucose repression or arabinose-inducible systems to minimize basal expression that may be toxic to host cells .

• Specialized host strains: Employing C41/C43(DE3) strains specifically designed for toxic membrane protein expression, or the Lemo21(DE3) strain allowing titration of expression levels.

• Co-expression strategies: Introduction of specific chaperones or foldases that assist in proper membrane protein folding.

When protein toxicity is observed through reduced growth rates or cell death, reducing the cultivation temperature to 16-20°C and inducer concentration can significantly improve viable protein yield .

What biophysical techniques are most informative for studying yjjB protein structure-function relationships?

Understanding the structure-function relationship of yjjB protein requires sophisticated biophysical approaches:

• Circular Dichroism (CD) spectroscopy: To determine secondary structure composition (α-helices, β-sheets) and thermal stability of purified yjjB.

• Nuclear Magnetic Resonance (NMR) spectroscopy: For detailed structural information, particularly of specific domains or in the presence of potential ligands.

• Fluorescence spectroscopy: Using intrinsic tryptophan fluorescence or extrinsic probes to monitor conformational changes upon ligand binding.

• Surface Plasmon Resonance (SPR): To quantify binding kinetics with potential interacting partners.

• Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): To map solvent-accessible regions and conformational dynamics.

• Molecular Dynamics (MD) simulations: Computational approach to predict protein behavior in membrane environments and identify potential binding sites.

These techniques should be applied systematically, starting with CD spectroscopy to confirm proper folding before proceeding to more sophisticated structural analyses.

How does sequence conservation of yjjB across E. coli strains inform functional predictions?

Comparative sequence analysis reveals that the yjjB protein sequence is highly conserved across different E. coli strains, including pathogenic and commensal variants:

This high degree of conservation suggests essential functional roles that resist evolutionary pressure. Sequence motif analysis identifies several preserved domains:

• N-terminal hydrophobic region (residues 10-30): Likely involved in membrane anchoring

• Conserved glycine-rich motif (residues 45-60): Potentially important for structural flexibility

• C-terminal charged residues (150-157): Possibly involved in protein-protein interactions

The strong conservation across pathogenic and non-pathogenic strains suggests that yjjB likely serves a fundamental physiological function rather than contributing directly to virulence, making it a potentially interesting target for broad-spectrum antibacterial research.

What are the methodological considerations for site-directed mutagenesis studies of yjjB protein?

Site-directed mutagenesis represents a powerful approach to probe structure-function relationships in yjjB protein. A systematic mutagenesis strategy should consider:

• Selection of target residues:

  • Highly conserved amino acids across bacterial species

  • Predicted functional motifs or domains

  • Charged residues in transmembrane regions

  • Potential phosphorylation or glycosylation sites

• Mutagenesis technique selection:

  • QuikChange PCR-based method for single mutations

  • Gibson Assembly for multiple simultaneous mutations

  • Golden Gate Assembly for systematic alanine-scanning libraries

• Validation approaches:

  • Western blotting to confirm expression of mutant variants

  • Circular dichroism to verify proper folding is maintained

  • Functional assays to assess impact on activity

• Essential controls:

  • Conservative and non-conservative substitutions at each position

  • Expression level normalization across mutants

  • Wild-type protein as positive control

A recommended initial approach would be an alanine-scanning mutagenesis of highly conserved residues, followed by more specific substitutions based on preliminary findings. This methodical process can identify critical functional residues and inform structural models of yjjB protein.

What emerging technologies show promise for advancing yjjB protein research?

Several cutting-edge technologies are poised to accelerate understanding of yjjB protein structure and function:

• Cryo-electron microscopy (cryo-EM): Recent advances in resolution capabilities make this technique increasingly valuable for membrane protein structural determination without crystallization.

• AlphaFold2 and related AI-based structural prediction tools: These computational approaches can generate high-confidence structural models to guide experimental design.

• Native mass spectrometry: Enables analysis of intact membrane protein complexes in near-native states to identify interaction partners.

• High-throughput phenotypic screening: Automated systems for testing yjjB mutants under diverse growth conditions to identify phenotypic signatures.

• Single-molecule techniques: FRET and optical tweezers can provide insights into conformational dynamics at unprecedented resolution.

Researchers should consider integrating these emerging technologies with established approaches to develop a comprehensive understanding of yjjB protein biology.

How can heterologous expression systems be optimized for functional studies of yjjB protein?

When expressing yjjB protein for functional studies, researchers must carefully consider expression system selection based on research objectives:

• Bacterial systems (E. coli):

  • Advantages: High yield, rapid growth, economical, straightforward genetic manipulation

  • Limitations: Lack of post-translational modifications, potential toxicity

  • Optimization: Use specialized strains like C41/C43(DE3), Lemo21(DE3), or SHuffle for improved membrane protein expression

• Yeast systems (P. pastoris, S. cerevisiae):

  • Advantages: Eukaryotic processing, higher membrane capacity, moderate cost

  • Limitations: Longer expression time, different membrane composition

  • Optimization: Codon optimization, selection of appropriate promoters (AOX1, GAP)

• Insect cell systems (Sf9, High Five):

  • Advantages: Complex eukaryotic processing, efficient membrane protein folding

  • Limitations: Higher cost, technical complexity

  • Optimization: Optimize multiplicity of infection, harvest timing

• Mammalian cell systems (HEK293, CHO):

  • Advantages: Native-like membrane environment, complete post-translational modifications

  • Limitations: Highest cost, lowest yield, complex culture conditions

  • Optimization: Stable cell line development, optimized media formulations

The choice of expression system should align with specific research questions, balancing authentic folding and modifications against practical considerations of yield and cost.