Recombinant Escherichia coli O127:H6 UPF0761 membrane protein yihY (yihY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yihY; E2348C_4187; UPF0761 membrane protein YihY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Target Names
yihY
Target Protein Sequence
MLKTIQDKAKHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAA FPMFSDVSIQLRHFIFANFLPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSI DSALNTIWRSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEDDEP
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structural composition of the UPF0761 membrane protein yihY?

The UPF0761 membrane protein yihY from Escherichia coli O127:H6 (strain E2348/69 / EPEC) is a full-length protein consisting of 290 amino acids. The complete amino acid sequence begins with mLKTIQDKAKHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAA and continues through to the C-terminal sequence ITVTLGEYRKLKQAAEQEEDDEP. The protein contains transmembrane domains characteristic of integral membrane proteins, with hydrophobic regions that anchor it within the bacterial membrane . The Uniprot accession number for this protein is B7UNK3, and its gene is designated in the E. coli genome as ordered locus name E2348C_4187 .

How is the yihY protein classified within the context of E. coli membrane proteins?

The yihY protein belongs to the UPF (Uncharacterized Protein Family) 0761 classification of membrane proteins in E. coli. While it shares structural characteristics with other bacterial membrane proteins, it represents a distinct family whose complete functional characterization remains ongoing. Unlike the well-studied outer membrane proteins such as OmpA, OmpC, and BamA that have established roles in bacterial pathogenesis and immune responses , the UPF0761 family, including yihY, represents a group of proteins whose precise biological functions are still being elucidated through ongoing research.

What are the predicted functional domains of the yihY protein based on sequence analysis?

Based on sequence analysis, the yihY protein contains several predicted transmembrane helices that likely span the bacterial membrane. The protein's sequence suggests it has hydrophobic regions consistent with membrane integration, particularly in segments such as "LSLVPLVAVVFALFAA" and "SLAISSYLLSLRWASD" . While specific binding domains have not been fully characterized, the presence of conserved motifs within the sequence suggests potential involvement in membrane transport or signaling processes. Researchers should conduct further domain analysis using bioinformatics tools such as TMHMM for transmembrane prediction and PROSITE for motif identification to better understand the functional architecture of this protein.

What expression systems are most effective for producing recombinant yihY protein?

For recombinant expression of membrane proteins like yihY, E. coli-based expression systems offer several advantages including low cost, genetic tractability, and established protocols for large-scale synthesis . When expressing membrane proteins specifically, fusion-based expression strategies have proven particularly effective. One recommended approach is to utilize the pOmpF fusion system, which employs an engineered fragment of outer membrane protein F to direct full-length membrane protein overexpression . This method has been shown to significantly improve yield for challenging membrane proteins by directing them to inclusion bodies, thereby minimizing toxicity associated with membrane disruption during high-level expression .

How can researchers optimize purification protocols for yihY to ensure protein stability?

To optimize purification of yihY protein while maintaining stability, a multi-step protocol is recommended:

  • Initial solubilization: After expression, solubilize protein in a Tris-based buffer containing an appropriate detergent such as FC15, which has proven effective for membrane proteins .

  • Affinity purification: Utilize histidine-tagged constructs for immobilized metal affinity chromatography (IMAC), with gradual imidazole elution to maintain protein integrity .

  • Tag removal: If using a fusion strategy such as OmpF, employ thrombin digestion which remains effective even in the presence of detergents like FC15 .

  • Storage optimization: Maintain the purified protein in a Tris-based buffer with 50% glycerol at -20°C for regular use, or at -80°C for extended storage . Importantly, avoid repeated freeze-thaw cycles as these significantly reduce protein stability .

A critical consideration during purification is detergent selection, as this dramatically impacts membrane protein stability and subsequent structural studies.

What quality control measures should be implemented to assess the integrity of purified yihY protein?

Multiple analytical methods should be employed to verify the integrity of purified yihY protein:

Analytical MethodPurposeExpected Results for High-Quality yihY
SDS-PAGEPurity assessmentSingle band at approximately 32 kDa
Western blotIdentity confirmationPositive signal with anti-His or specific antibody
Circular dichroism (CD)Secondary structure analysisPredominant α-helical content (similar to other membrane proteins)
Size exclusion chromatographyAggregation analysisSingle, symmetrical peak
Mass spectrometryMolecular weight verificationMatch to theoretical mass of 32,419 Da

Additionally, functional assays specific to membrane proteins should be considered, such as reconstitution into liposomes to verify membrane insertion capability. Researchers should monitor protein stability over time at different temperatures, with samples stored at 4°C showing minimal degradation over a one-week period .

What spectroscopic methods are most informative for analyzing the secondary structure of yihY?

Circular dichroism (CD) spectroscopy represents the gold standard for analyzing secondary structure composition of membrane proteins like yihY. Based on studies of similar membrane proteins, full-length membrane proteins often display predominantly α-helical characteristics in CD analysis . For yihY specifically, researchers should focus on far-UV CD spectra (190-260 nm), where α-helical structures typically produce characteristic negative bands at 208 and 222 nm.

Fourier-transform infrared spectroscopy (FTIR) provides complementary information, particularly for proteins in detergent environments. When analyzing yihY, researchers should combine multiple spectroscopic techniques and compare results to structural predictions from the amino acid sequence, which suggests significant α-helical content particularly in the transmembrane regions .

How can researchers assess the thermal stability of the yihY protein?

To comprehensively assess thermal stability of yihY, researchers should employ a multi-technique approach:

  • Differential scanning calorimetry (DSC): Measure heat capacity changes during temperature-induced unfolding to determine the melting temperature (Tm).

  • Temperature-dependent CD spectroscopy: Monitor changes in secondary structure at increasing temperatures (20-90°C), recording spectra at 5°C intervals to identify transition points.

  • Fluorescence-based thermal shift assays: Utilize intrinsic tryptophan fluorescence or extrinsic dyes to monitor unfolding.

For membrane proteins similar to yihY, thermal stability often shows detergent-dependence. In studies of comparable membrane proteins, samples maintained in appropriate detergents like FC15 have demonstrated remarkable thermal stability, retaining structural integrity across a wide temperature range (20-60°C) . Researchers should establish a thermal stability profile specific to yihY to optimize buffer conditions for downstream applications.

What strategies can researchers employ for crystallization of the yihY protein for structural studies?

Crystallization of membrane proteins like yihY presents significant challenges that require specialized approaches:

  • Detergent screening: Systematically test multiple detergents (maltosides, glucosides, and newer amphipols) for their ability to maintain protein stability while permitting crystal contacts.

  • Lipidic cubic phase (LCP) crystallization: Consider this alternative to traditional vapor diffusion for membrane proteins, as it provides a more native-like environment.

  • Construct optimization: Design truncated constructs removing flexible regions while maintaining core structural elements to improve crystallization propensity.

  • Co-crystallization with antibodies: Fragment antigen-binding (Fab) or nanobody co-crystallization can provide additional crystal contacts.

An empirical approach involving sparse matrix screening across multiple conditions is essential, with careful optimization of protein concentration (typically 5-15 mg/mL), precipitants, pH (typically pH 6-8 for membrane proteins), and temperature. Alternative structural approaches such as cryo-electron microscopy should be considered if crystallization proves particularly challenging.

What approaches can researchers use to identify potential interaction partners of yihY?

To identify interaction partners of yihY, researchers should implement a multi-faceted approach:

  • Pull-down assays: Utilize the His-tagged yihY protein for affinity purification coupled with mass spectrometry to identify co-purifying proteins from E. coli lysates.

  • Bacterial two-hybrid systems: Adapt traditional yeast two-hybrid methods to bacterial systems more appropriate for membrane protein interaction studies.

  • Crosslinking mass spectrometry: Apply chemical crosslinkers followed by proteomic analysis to capture transient interactions.

  • Bioinformatic prediction: Analyze genomic context and co-expression patterns to identify functionally related proteins. For yihY specifically, examining the yih operon structure may provide insights into functional relationships with other proteins encoded in the same genomic region.

When analyzing potential interaction partners, researchers should consider the membrane localization of yihY and focus on proteins with compatible subcellular distributions. Control experiments using other membrane proteins are essential to distinguish specific from non-specific interactions.

How can researchers assess the membrane insertion and topology of the yihY protein?

Several complementary approaches can determine membrane insertion and topology of yihY:

  • Protease accessibility assays: Expose membrane preparations containing yihY to proteases, then analyze protected fragments by mass spectrometry to map membrane-embedded regions.

  • Cysteine scanning mutagenesis: Introduce cysteine residues throughout the protein sequence and assess their accessibility to membrane-impermeable labeling reagents.

  • GFP-fusion analysis: Create fusion proteins with GFP at different positions and analyze fluorescence distribution in bacterial cells.

  • PhoA/LacZ fusion reporter system: Generate translational fusions with these reporters whose activity depends on cytoplasmic or periplasmic localization.

Based on the amino acid sequence of yihY, which contains multiple hydrophobic stretches , researchers should anticipate a multi-pass membrane protein topology. Computational predictions using tools like TMHMM and MEMSAT should be experimentally validated using the approaches outlined above.

What functional assays might reveal the biological role of yihY in E. coli?

To elucidate the biological function of the relatively uncharacterized yihY protein, researchers should consider these approaches:

  • Gene knockout/knockdown studies: Create yihY deletion mutants and assess phenotypic changes under various growth conditions.

  • Overexpression analysis: Examine effects of yihY overexpression on bacterial growth, membrane integrity, and stress responses.

  • Comparative genomics: Analyze conservation patterns across bacterial species to identify potential functional insights.

  • Metabolomic profiling: Compare metabolite profiles between wild-type and yihY mutant strains to identify affected pathways.

  • Membrane transport assays: Test whether yihY affects the transport of specific substrates across the bacterial membrane.

Given that yihY belongs to the UPF0761 family (uncharacterized protein family), these functional studies are particularly important to establish its role. Researchers should initially focus on membrane-related processes given its predicted transmembrane structure .

How might researchers address the challenges of low expression yields when working with yihY protein?

Low expression yields, a common challenge with membrane proteins like yihY, can be addressed through several advanced strategies:

  • Fusion protein optimization: Implement the pOmpF fusion system specifically engineered for membrane proteins, which directs proteins to inclusion bodies and minimizes toxicity . The engineered fragment of OmpF (amino acids A23-S164; Uniprot ID P02931) has demonstrated consistent high-yield expression for challenging membrane proteins .

  • Expression strain engineering: Select specialized E. coli strains like C41(DE3) or C43(DE3) that are adapted for membrane protein overexpression and contain mutations that mitigate toxicity.

  • Induction optimization: Conduct a factorial design experiment varying:

    • IPTG concentration (0.1-1.0 mM)

    • Induction temperature (18-30°C)

    • Induction duration (4-24 hours)

    • OD600 at induction (0.4-1.2)

  • Codon optimization: Redesign the yihY gene sequence based on E. coli codon usage preferences while maintaining the amino acid sequence.

The combination of these approaches can dramatically improve expression yields, with fusion-based strategies particularly effective for increasing membrane protein production .

What are the considerations for designing site-directed mutagenesis experiments to probe yihY function?

When designing site-directed mutagenesis experiments for yihY, researchers should consider:

  • Evolutionary conservation: Prioritize residues conserved across yihY homologs in different bacterial species, as these often indicate functional importance.

  • Predicted functional domains: Based on the sequence , target:

    • Hydrophobic residues in predicted transmembrane regions

    • Charged residues at membrane interfaces

    • Potential binding pocket residues

    • The C-terminal region (GEYRKLKQAAEQEEDDEP) containing charged residues potentially involved in protein-protein interactions

  • Mutation selection strategy:

Residue TypeSuggested MutationRationale
Hydrophobic (L, I, V, F)AMaintains hydrophobicity but reduces side chain volume
Charged (D, E, K, R)N, Q or opposite chargeNeutralizes or reverses charge while maintaining polarity
Aromatic (W, Y, F)A or LEliminates aromatic interactions
ProlineARemoves conformational constraints

How can computational approaches complement experimental studies of yihY protein?

Computational methods offer powerful complements to experimental studies of yihY:

  • Molecular dynamics simulations: Model yihY in a lipid bilayer environment to understand:

    • Conformational dynamics

    • Lipid-protein interactions

    • Potential conformational changes

    These simulations should be run for extended periods (>100 ns) to capture relevant membrane protein dynamics.

  • Homology modeling: Despite low sequence identity with proteins of known structure, threading approaches can provide structural insights, particularly for the transmembrane regions.

  • Evolutionary coupling analysis: Methods like Direct Coupling Analysis (DCA) can identify co-evolving residues that likely interact physically, providing insights into structural constraints.

  • Binding site prediction: Computational detection of potential binding pockets can guide experimental design for functional studies.

  • Integration with experimental data: Refinement of computational models using sparse experimental constraints from crosslinking or spectroscopic studies can significantly improve model accuracy.

The integration of computational predictions with targeted experimental validation represents a particularly efficient approach for studying membrane proteins like yihY where structural studies may be challenging .

How does yihY compare structurally and functionally to other characterized membrane proteins in E. coli?

While yihY remains partially characterized, comparative analysis with well-studied E. coli membrane proteins provides valuable context:

Unlike the major outer membrane proteins such as OmpA, OmpC, and BamA, which have established roles in membrane integrity, transport, and pathogenesis , yihY belongs to the UPF0761 family with less defined functions. Structurally, yihY contains multiple predicted transmembrane domains , distinguishing it from the β-barrel architecture typical of outer membrane proteins like OmpA .

From a research methodology perspective, techniques successful for expression and purification of other E. coli membrane proteins, particularly the fusion-based approaches using OmpF fragments , provide valuable starting points for yihY studies. The high α-helical content observed in other membrane proteins through CD spectroscopy suggests similar secondary structure may be present in yihY , though experimental confirmation is necessary.

What insights can phylogenetic analysis provide about the evolutionary conservation and potential function of yihY?

Phylogenetic analysis of yihY can reveal crucial functional insights through several approaches:

  • Sequence conservation mapping: Identify highly conserved residues across bacterial species, which typically indicate functional importance. Researchers should generate multiple sequence alignments of yihY homologs and calculate conservation scores for each position.

  • Genomic context analysis: Examine the genetic neighborhood of yihY across different bacterial genomes. Genes consistently located near yihY may have related functions, providing clues to biological role.

  • Evolutionary rate analysis: Calculate the ratio of non-synonymous to synonymous substitutions (dN/dS) across the protein sequence. Regions under strong purifying selection (low dN/dS) often indicate functional importance.

  • Domain architecture comparison: Analyze whether domain architecture is conserved across homologs or if certain species contain additional domains that might suggest functional specialization.

This evolutionary analysis can guide experimental design by identifying the most promising regions for functional studies or mutagenesis.

How might researchers leverage cross-species comparisons to identify potential functions of yihY?

Cross-species functional genomics represents a powerful approach to infer yihY function:

  • Complementation studies: Express yihY homologs from different bacterial species in E. coli yihY knockout strains to assess functional conservation.

  • Comparative phenotyping: Compare phenotypes of yihY gene deletions across multiple bacterial species to identify consistent patterns.

  • Co-expression network analysis: Identify genes consistently co-expressed with yihY across multiple species, suggesting functional relationships.

  • Synteny analysis: Examine conservation of gene order around yihY locus, as functionally related genes often maintain proximity through evolution.

This comparative approach is particularly valuable for uncharacterized proteins like yihY, as it can reveal functional associations not immediately apparent from sequence analysis alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.