Recombinant Escherichia coli O127:H6 Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Description

Protein Architecture

ZntB belongs to the CorA family of cation transporters but is uniquely specialized for zinc efflux in enteric bacteria. Key structural features include:

  • Transmembrane β-barrel domains: Predicted 26 β-strands forming a monomeric β-barrel structure with an internal globular domain .

  • His-tag modification: Recombinant ZntB is typically expressed with an N-terminal His-tag (10×His) for nickel-nitrilotriacetic acid (Ni-NTA) affinity chromatography .

  • Sequence alignment: Full-length protein spans 327 amino acids (1–327 aa), with a molecular weight of ~36 kDa .

ParameterValueSource
Gene identifierzntB (E2348C_1534)
UniProt IDB7URE7
Expression hostE. coli (BL21(DE3) or similar strains)
Purification methodNi-NTA affinity chromatography
Purity>90% (SDS-PAGE verified)

Functional Role in Zinc Homeostasis

ZntB is critical for maintaining intracellular zinc concentrations by mediating efflux:

Key Findings

  • Zn²⁺ efflux activity:

    • zntB mutants exhibit hypersensitivity to Zn²⁺ and Cd²⁺ toxicity, confirming its role in detoxification .

    • Transport assays in E. coli membrane vesicles show ZntB-dependent Zn²⁺ efflux with a V<sub>max</sub> of 0.57 nmol Zn²⁺/min/mg protein .

  • Substrate specificity:

    • Binds Zn²⁺, Co²⁺, Cu²⁺, and Ni²⁺ but not Mg²⁺ or Mn²⁺ .

    • Histidine residues (e.g., H53, H159) are essential for metal binding .

Transport PropertyZntBComparative Transporters
SubstrateZn²⁺, Cd²⁺ZitB (CDF family): Zn²⁺, Co²⁺, Cd²⁺
DirectionalityEffluxEfflux (ZitB), Influx (CorA Mg²⁺)
Energy dependenceProton motive force (PMF)PMF-driven (ZitB)

Production and Purification

Recombinant ZntB is produced via optimized E. coli expression systems:

Expression Strategies

  • Host strains: BL21(DE3) or derivatives (e.g., C41(DE3)) for high-yield membrane protein production .

  • Plasmid design: zntB cloned under T7 promoters (e.g., pET28a) with signal peptides for periplasmic targeting (e.g., pelB) .

  • Induction: IPTG-induced expression at 16–30°C to reduce inclusion body formation .

ParameterOptimal ConditionRationale
Induction temperature16–20°CEnhances soluble protein yield
Induction duration4–6 hoursBalances yield and solubility
Lysis buffer pHpH 8.0 (Tris-based)Preserves His-tag binding capacity

Genomic and Functional Insights

  • Genomic context: zntB is part of the EPEC O127:H6 (strain E2348/69) genome, linked to pathogen survival in zinc-rich host environments .

  • Comparative analysis: Unlike CorA (Mg²⁺ influx), ZntB lacks Mg²⁺ transport activity, highlighting functional divergence .

  • Transport kinetics: In E. coli vesicles, ZntB-mediated Zn²⁺ efflux exhibits a K<sub>m</sub> of 1.4 μM .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If a particular tag type is required, please specify this during ordering, and we will prioritize its inclusion.
Synonyms
zntB; E2348C_1534; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Target Names
zntB
Target Protein Sequence
MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ FGFSIFCILLVVLIGGVALWLHRSKWL
Uniprot No.

Target Background

Function
Mediates the efflux of zinc ions.
Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does ZntB differ from other zinc transporters in E. coli?

E. coli possesses several zinc transport systems with distinct mechanisms and affinities:

TransporterFamilyTransport MechanismDirectionMetal SpecificityATP Requirement
ZntBCorA-likeProton gradient drivenImportPrimarily Zn²⁺No
ZnuACBABC transporterATP hydrolysisImportHighly specific for Zn²⁺Yes
ZupTZIP familyChemiosmotic gradientImportZn²⁺, Co²⁺, Fe²⁺, Mn²⁺No
SitABCDABC transporterATP hydrolysisImportPrimarily Mn²⁺, Fe²⁺ (Zn²⁺ binding but limited transport)Yes

ZntB is distinctive in its pentameric assembly and proton-driven transport mechanism. While ZnuACB is considered the predominant high-affinity zinc importer under severe zinc limitation, ZntB appears to operate under different conditions and may have distinct regulatory mechanisms .

What is the genomic context of zntB in E. coli O127:H6?

In E. coli O127:H6 (strain E2348/69), the zntB gene is identified by the ordered locus name E2348C_1534 . This strain belongs to enteropathogenic E. coli (EPEC), the first pathovar of E. coli implicated in human disease .

The complete genome sequence of E. coli O127:H6 strain E2348/69 has revealed that it belongs to phylogroup B2 and contains specific genomic features that differ from other E. coli pathotypes. The strain possesses a type III secretion system (T3SS) and associated effector proteins that are crucial for its virulence mechanism .

The genomic context of zntB may influence its expression patterns. Unlike some zinc transporters whose expression is strongly induced under zinc limitation, zntB expression may be regulated differently. Studies in related bacteria like C. metallidurans suggest that zntB is downregulated in the presence of high concentrations of Zn²⁺, Cd²⁺, and Cu²⁺, supporting its role as an importer rather than an exporter .

How do researchers express and purify recombinant ZntB protein?

Expression and purification of recombinant ZntB typically follows this methodology:

  • Construct Design:

    • Clone the zntB gene (E2348C_1534) from E. coli O127:H6 into a T7 promoter-based expression vector

    • Include a fusion tag (His-tag is common) to facilitate purification

    • Verify the construct by sequencing

  • Expression Protocol:

    • Transform the construct into an E. coli expression strain (typically BL21(DE3) or derivatives)

    • Grow cells in LB medium at 37°C until mid-log phase (OD600 of 0.6-0.9)

    • Cool cultures to 18°C before induction with IPTG (typically 0.5 mM)

    • Continue expression overnight at 18°C with vigorous shaking (200-250 rpm)

    • The lower temperature promotes proper folding of membrane proteins

  • Membrane Fraction Isolation:

    • Harvest cells by centrifugation

    • Resuspend in buffer containing protease inhibitors

    • Lyse cells using sonication or pressure-based methods

    • Remove cell debris by centrifugation

    • Isolate membrane fraction through ultracentrifugation

  • Protein Solubilization and Purification:

    • Solubilize membrane proteins using a suitable detergent (e.g., n-dodecyl-β-D-maltoside)

    • Purify using immobilized metal affinity chromatography (IMAC)

    • Perform size exclusion chromatography to isolate the pentameric complex

    • Confirm protein purity by SDS-PAGE and identity by mass spectrometry

  • Storage Considerations:

    • Store in Tris-based buffer with 50% glycerol at -20°C

    • For extended storage, maintain at -80°C

    • Avoid repeated freeze-thaw cycles

    • For short-term use, store working aliquots at 4°C for up to one week

This protocol typically yields functional recombinant ZntB protein suitable for structural and functional studies.

What experimental approaches can be used to characterize ZntB transport activity?

Several complementary approaches have been used to characterize the transport activity of ZntB:

  • Radioactive Zinc (⁶⁵Zn²⁺) Uptake Assays:

    • Reconstitute purified ZntB into liposomes

    • Prepare liposomes with varying internal pH to test proton gradient dependence

    • Incubate liposomes with ⁶⁵Zn²⁺

    • Separate liposomes from free ⁶⁵Zn²⁺ using filtration or gel filtration

    • Measure accumulated radioactivity using scintillation counting

    • Include appropriate controls (empty liposomes, liposomes with inactivated protein)

  • Fluorescent Transport Assays:

    • Incorporate zinc-sensitive fluorophores (e.g., FluoZin-3) into liposomes

    • Monitor fluorescence changes in real-time using spectrofluorometry

    • Test various conditions (pH gradients, inhibitors, competing ions)

    • Quantify transport rates under different conditions

  • Isothermal Titration Calorimetry (ITC):

    • Measure binding affinity of zinc to purified ZntB

    • Determine thermodynamic parameters of binding

    • Assess the impact of mutations on zinc binding

  • Electrophysiological Measurements:

    • Incorporate ZntB into planar lipid bilayers or giant unilamellar vesicles

    • Measure ion currents using patch-clamp techniques

    • Characterize transport kinetics and ion selectivity

  • pH-Dependent Assays:

    • Create artificial pH gradients across liposomal membranes

    • Measure zinc transport as a function of ΔpH

    • Use pH indicators to monitor proton movement coupled to zinc transport

Research has shown that ZntB-mediated zinc transport is stimulated by a pH gradient across the membrane, supporting a Zn²⁺/H⁺ co-transport mechanism that differs fundamentally from the channel-like mechanism of CorA magnesium transporters .

How can researchers investigate the structural dynamics of ZntB during transport?

Understanding the structural changes ZntB undergoes during transport requires sophisticated techniques:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Prepare ZntB samples in various conditions (with/without zinc, different pH)

    • Collect high-resolution cryo-EM data

    • Solve structures representing different conformational states

    • Compare structural changes in response to zinc binding/transport

  • Molecular Dynamics (MD) Simulations:

    • Build atomistic models of ZntB in a lipid bilayer

    • Simulate zinc transport under various conditions

    • Identify key residues involved in zinc coordination and transport

    • Predict conformational changes during the transport cycle

  • Site-Directed Spin Labeling and Electron Paramagnetic Resonance (EPR):

    • Introduce cysteine residues at strategic positions

    • Label with spin probes

    • Measure distances between labeled residues in different conditions

    • Track conformational changes during zinc binding and transport

  • Single-Molecule Förster Resonance Energy Transfer (smFRET):

    • Introduce fluorophore pairs at key positions

    • Monitor real-time conformational changes at the single-molecule level

    • Correlate structural dynamics with transport activity

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Expose ZntB to D₂O under various conditions

    • Analyze patterns of deuterium incorporation

    • Identify regions with altered solvent accessibility during transport

Comparison of available structures indicates that ZntB likely undergoes significant conformational changes during transport. For example, comparing the full-length structure of E. coli ZntB with the soluble domain of S. typhimurium ZntB reveals dramatic differences in surface electrostatic potential and internal pore shape, which may represent different functional states .

How can researchers distinguish between contradictory hypotheses regarding ZntB's transport direction?

The literature contains contradicting claims about whether ZntB functions as an importer or exporter. This methodological approach can help resolve this contradiction:

  • Complementary Genetic and Biochemical Approaches:

    • Generate zntB knockout strains in E. coli O127:H6

    • Assess growth under zinc-limited and zinc-replete conditions

    • Measure intracellular zinc levels using specific probes (e.g., FluoZin-3)

    • Complement with wild-type and mutant versions of zntB

  • In vitro Transport Assays with Defined Orientation:

    • Reconstitute ZntB into proteoliposomes with controlled orientation

    • Establish zinc gradients and measure flux direction

    • Test the effect of proton gradients on transport direction

  • Comparative Analysis with Strains Having Different Zinc Transporters:

    • Create strains with various combinations of zinc transporters (e.g., ZntB+/ZnuACB−, ZntB−/ZnuACB+)

    • Challenge with different zinc concentrations and stressors

    • Measure growth, zinc accumulation, and stress responses

  • Expression Pattern Analysis:

    • Monitor zntB expression under various zinc concentrations

    • Compare with known importers (znuACB) and exporters

    • Analyze promoter regulation mechanisms

  • Combination with Other Physiological Assays:

    • Assess impact on biofilm formation under zinc stress

    • Measure oxidative stress resistance (H₂O₂ sensitivity)

    • Evaluate motility under zinc-limited conditions

Research now strongly suggests that ZntB functions primarily as a zinc importer stimulated by proton gradients. This contrasts with earlier hypotheses from whole-cell experiments that suggested an export function. The downregulation of zntB expression in the presence of high zinc concentrations in C. metallidurans further supports its role as an importer rather than an exporter .

What are the methodological challenges in studying the physiological role of ZntB in E. coli O127:H6?

Investigating ZntB function in vivo presents several challenges:

  • Functional Redundancy:

    • E. coli possesses multiple zinc transport systems (ZnuACB, ZupT)

    • Single knockout studies may show limited phenotypes due to compensation

    • Solution: Generate multiple knockouts (Δznu ΔzupT ΔzntB) and complementation strains

  • Zinc Speciation and Bioavailability:

    • Zinc exists in various forms with different bioavailabilities

    • Media composition significantly affects zinc availability

    • Solution: Use defined media with controlled zinc speciation; employ zinc chelators strategically

  • Host-Relevant Conditions:

    • Laboratory conditions poorly mimic host environments

    • Zinc availability in host tissues may be vastly different

    • Solution: Test growth in host-mimicking media (e.g., human urine for UPEC studies); use infection models

  • Strain-Specific Differences:

    • Zinc transport systems may function differently across E. coli strains

    • Regulatory networks vary between commensal and pathogenic strains

    • Solution: Compare multiple strains; consider regulatory context

  • Stress Response Interference:

    • Zinc starvation triggers multiple stress responses

    • Phenotypes may result from secondary effects

    • Solution: Monitor specific zinc-dependent processes (e.g., activity of zinc-dependent enzymes)

Studies have shown that zinc transporters in E. coli contribute to oxidative stress resistance and motility. For example, zinc transport mutants showed increased sensitivity to H₂O₂, which could be restored by zinc supplementation . Such phenotypes provide functional readouts for ZntB activity in vivo.

How can researchers design mutations in ZntB to understand its transport mechanism?

Strategic mutagenesis approaches can illuminate ZntB's transport mechanism:

  • Structure-Guided Mutagenesis Strategy:

    • Target residues in three key regions:
      a) Zinc coordination sites
      b) Putative proton-binding residues
      c) Gating regions

    • Create single, double, and compensatory mutations

  • Specific Residue Categories to Target:

    • Conserved charged residues in transmembrane helices (potential proton pathway)

    • Histidine, cysteine, aspartate, and glutamate residues (potential zinc coordination)

    • Residues at the subunit interfaces (important for conformational changes)

    • Conserved residues in the central pore (transport pathway)

  • Functional Assessment Methods:

    • In vitro transport assays with purified proteins reconstituted into liposomes

    • Growth complementation assays in zinc transport-deficient strains

    • Protein stability and oligomerization analysis

    • Zinc binding measurements using ITC or fluorescence approaches

  • Systematic Analysis of TM1 Residues:

    • TM1 contains highly conserved basic and acidic residues on adjacent faces

    • Helical rotation of TM1 may be involved in charge inversion along the transport pathway

    • Create a scanning mutagenesis library across TM1

A proposed helical rotation mechanism for ZntB involves transmembrane helix 1 (TM1), which contains conserved basic and acidic residues on adjacent faces. Rotation of this helix during transport could explain the observed differences in internal pore charge between different conformational states .

What approaches can researchers use to study the role of ZntB in bacterial pathogenesis?

To investigate ZntB's contribution to virulence:

  • Animal Infection Models:

    • Generate zntB knockout strains and complemented controls

    • Perform competitive infections with wild-type and mutant strains

    • Assess colonization and bacterial loads in different tissues

    • Measure inflammatory responses and host damage

  • Virulence-Associated Phenotypes:

    • Biofilm formation assays under zinc-limited conditions

    • Oxidative stress resistance (H₂O₂ challenge)

    • Motility assays

    • Assessment of zinc-dependent virulence factor expression

  • Host-Pathogen Interaction Studies:

    • Investigate the role of host-mediated zinc sequestration (nutritional immunity)

    • Assess impact of calprotectin (zinc-sequestering host protein) on ZntB-dependent growth

    • Study intracellular bacterial communities in epithelial cells

  • Expression Analysis During Infection:

    • Use reporter constructs to monitor zntB expression in vivo

    • Perform transcriptomics and proteomics on bacteria recovered from infection sites

    • Compare expression patterns between commensal and pathogenic strains

  • Combined Mutant Analysis:

    • Generate mutants lacking multiple zinc transport systems

    • Assess virulence factor production in these backgrounds

    • Evaluate combined effects on pathogenesis

Studies with zinc transport mutants in uropathogenic E. coli have shown significant virulence attenuation. For example, Δznu mutants showed reduced colonization in mouse urinary tract infection models, with mean 4.4-fold reduction in bladders and 41-fold reduction in kidneys. Double mutants (ΔznuΔzupT) showed even more pronounced effects (30-fold and 48-fold reductions, respectively) .

How does zinc transport through ZntB affect other cellular processes in E. coli?

Zinc homeostasis through ZntB impacts multiple cellular processes:

  • Oxidative Stress Response:

    • Zinc plays a protective role against oxidative damage

    • ZntB contributes to H₂O₂ resistance, possibly by ensuring zinc availability for the Cu/Zn superoxide dismutase (SodC)

    • Zinc protects against iron-triggered membrane lipid oxidation

  • Biofilm Formation:

    • Zinc levels significantly impact biofilm development

    • Altered zinc transport affects cell surface properties and adhesin expression

    • Experimental data shows zinc exposure (via ZnO) increases biofilm formation by up to 150% compared to controls

  • Cell Morphology and Division:

    • Zinc-dependent enzymes participate in cell wall synthesis

    • Zinc depletion can alter peptidoglycan structure

    • Microscopic examination of zinc transport mutants may reveal morphological changes

  • Gene Expression Regulation:

    • Zinc is a cofactor for numerous transcription factors

    • ZntB-mediated zinc import influences zinc-responsive regulators like Zur

    • Whole-transcriptome analysis reveals zinc affects genes involved in antibiotic response, heat stress, growth regulation, and cell shape

  • Ribosome Function:

    • E. coli 70S ribosomes tightly bind 8 equivalents of Zn²⁺

    • Zinc is required for several ribosomal proteins (L36, L31, L13, L2, S17, S16, S15, S2)

    • Proper zinc transport ensures accurate protein synthesis

The connections between zinc transport and these cellular processes explain why ZntB and other zinc transporters are important for bacterial fitness under various stress conditions.

What experimental design is appropriate for testing the hypothesis that ZntB functions in a proton-driven zinc import mechanism?

To test this hypothesis rigorously:

  • Liposome-Based Transport Assays:

    • Reconstitute purified ZntB into liposomes

    • Create different pH gradients (ΔpH) across the membrane

    • Measure zinc uptake using either radioactive ⁶⁵Zn²⁺ or fluorescent zinc indicators

    • Plot zinc transport rates as a function of ΔpH

    • Control: Perform assays with collapsed pH gradients using ionophores

  • Site-Directed Mutagenesis of Proton Pathway:

    • Identify putative proton-binding residues based on structural analysis

    • Create mutants with altered proton-binding capacity

    • Test transport activity and pH dependence of mutants

    • Examine if uncoupling the proton gradient affects zinc transport

  • Simultaneous Measurement of Proton and Zinc Movement:

    • Incorporate both pH-sensitive and zinc-sensitive fluorophores in liposomes

    • Monitor changes in both signals during transport

    • Calculate stoichiometry of H⁺/Zn²⁺ coupling

  • Electrophysiological Characterization:

    • Perform patch-clamp recordings of ZntB-containing membranes

    • Measure current-voltage relationships at different pH values

    • Determine if transport is electrogenic (indicating coupled ion movement)

  • In vivo Transport Studies:

    • Express ZntB in zinc-sensitive reporter strains

    • Manipulate external and internal pH using weak acids/bases

    • Monitor zinc accumulation under different ΔpH conditions

    • Compare results with known proton-coupled transporters

The research by Gati et al. (2017) employing cryo-EM structural analysis, isothermal titration calorimetry, and radioligand uptake and fluorescent transport assays with ZntB reconstituted into liposomes strongly supports a proton-driven zinc import mechanism .

How can researchers optimize the expression of soluble and functional recombinant ZntB?

Membrane proteins like ZntB present specific challenges for expression. Here's a systematic approach:

  • Expression System Optimization:

    • Test multiple E. coli strains (BL21(DE3), C41(DE3), C43(DE3), Lemo21(DE3))

    • Compare T7 vs. arabinose-inducible systems

    • Consider codon optimization for the E. coli O127:H6 sequence

    • Evaluate different fusion tags (His, MBP, SUMO) for improving solubility

  • Induction Parameter Optimization:

    ParameterRange to TestRationale
    Temperature15-30°CLower temperatures slow folding and prevent inclusion bodies
    Inducer concentration0.1-1.0 mM IPTGLower concentrations may improve folding
    Cell density at inductionOD₆₀₀ 0.4-1.0Optimal density depends on strain and construct
    Post-induction time4-24 hoursLonger times at lower temperatures often improve yield
    Media compositionLB, TB, M9, auto-inductionRich media may improve yield but defined media allow better control
  • Solubilization and Purification Strategy:

    • Screen multiple detergents (DDM, LDAO, LMNG, SMA copolymer)

    • Test detergent concentration and solubilization time

    • Evaluate different buffer compositions (pH 6.5-8.5)

    • Include stabilizing additives (glycerol, specific lipids, zinc)

  • Functional Assessment:

    • Confirm pentameric assembly by size exclusion chromatography

    • Verify zinc binding by ITC or fluorescence-based assays

    • Test transport activity in reconstituted systems

    • Assess structural integrity by circular dichroism or limited proteolysis

  • Troubleshooting Common Issues:

    • Poor expression: Check for toxicity, reduce inducer, change promoter

    • Inclusion bodies: Lower temperature, use solubility-enhancing tags, try refolding

    • Aggregation during purification: Optimize detergent and buffer conditions

    • Loss of activity: Include zinc during purification, minimize oxidation

The optimal conditions often involve expression at 18°C following induction, as this lower temperature facilitates proper folding and assembly of the pentameric complex .

What control experiments are essential when investigating zinc transport through ZntB?

Robust controls ensure reliable interpretation of ZntB transport data:

  • Negative Controls:

    • Empty liposomes without ZntB (background leakage control)

    • Liposomes with inactivated ZntB (heat-treated or specific inhibitor)

    • Transport assays in the presence of excess competing divalent cations

    • Experiments with ZntB mutants lacking key functional residues

  • Positive Controls:

    • Known zinc ionophore (e.g., pyrithione) for maximum transport reference

    • Well-characterized zinc transporter (if available) for comparison

    • Demonstration of functional reconstitution using an established assay

  • Specificity Controls:

    • Transport assays with other divalent cations (Mg²⁺, Cd²⁺, Co²⁺)

    • Competition experiments with varying ratios of zinc and competing ions

    • pH dependence tests to confirm proton coupling

  • System Validation Controls:

    • Verification of protein orientation in liposomes

    • Confirmation of liposome integrity during assays

    • Demonstration of consistent liposome size and composition

    • Protein-to-lipid ratio optimization experiments

  • In vivo Controls:

    • Wild-type strain (positive control)

    • Multiple zinc transporter knockout combinations

    • Complementation with wild-type and mutant versions of zntB

    • Expression level verification by western blot

Critical controls for radioligand or fluorescent uptake assays should include timepoints with and without ionophores to demonstrate that measured zinc accumulation represents transporter-mediated uptake rather than binding to the membrane surface or nonspecific leakage .

How should researchers interpret conflicting data regarding ZntB's role in zinc homeostasis?

When faced with contradictory findings:

  • Systematic Comparison of Experimental Conditions:

    • Create a comprehensive table comparing:

      • Bacterial strains used (commensal vs. pathogenic, genetic background)

      • Growth media composition (defined vs. complex, zinc concentrations)

      • Experimental readouts (growth, direct transport, gene expression)

      • Genetic manipulations (single vs. multiple knockouts)

  • Consider System-Specific Factors:

    • Strain-specific zinc requirements

    • Presence of additional uncharacterized transporters

    • Regulatory differences between strains

    • Experimental artifacts from overexpression or tagging

  • Integrate Multiple Lines of Evidence:

    • Direct transport measurements (in vitro reconstituted systems)

    • Genetic data (knockout phenotypes)

    • Expression patterns (induction/repression by zinc)

    • Structural insights (transport mechanism)

    • Evolutionary conservation and genomic context

  • Address Specific Contradictions:

    • Import vs. export function: Consider physiological direction under relevant conditions

    • Redundancy with other transporters: Analyze double/triple knockouts

    • Significance for virulence: Compare results from different infection models

  • Design Decisive Experiments:

    • Combined approaches using both in vitro and in vivo systems

    • Careful control of zinc speciation and availability

    • Analysis of regulatory cross-talk between different transporters

Resolving conflicting reports about ZntB requires considering that early whole-cell zinc extrusion experiments may have overlooked the contribution of other transporters. More recent structural, biochemical, and expression data strongly support ZntB as a proton-driven zinc importer rather than an exporter .

Research Resources and Methodological Considerations

What are the most reliable methods for measuring intracellular zinc levels when studying ZntB function?

When investigating ZntB's impact on cellular zinc homeostasis, several complementary approaches are recommended:

  • Radioactive ⁶⁵Zn²⁺ Accumulation:

    • Incubate cells with ⁶⁵Zn²⁺ under defined conditions

    • Wash cells to remove external zinc

    • Measure cell-associated radioactivity

    • Advantages: Quantitative, high sensitivity

    • Limitations: Requires radioactive handling facilities, measures total rather than free zinc

  • Fluorescent Zinc Probes:

    • Genetically encoded sensors (e.g., FRET-based sensors)

    • Cell-permeable fluorophores (FluoZin-3 AM, Zinpyr-1)

    • Flow cytometry or fluorescence microscopy readouts

    • Advantages: Can measure free zinc, potential for subcellular resolution

    • Limitations: May perturb cellular zinc pools, calibration challenges

  • Inductively Coupled Plasma Mass Spectrometry (ICP-MS):

    • Digest cell samples completely

    • Measure total zinc content with high precision

    • Compare with other essential elements

    • Advantages: Multi-element analysis, highly quantitative

    • Limitations: Requires specialized equipment, measures total zinc only

  • Genetically Encoded Biosensors:

    • Expression of zinc-responsive promoters fused to reporter genes

    • Measurement of cellular responses to zinc fluctuations

    • Advantages: Reports on physiologically relevant zinc pools

    • Limitations: Indirect measurement, potential for regulatory artifacts

  • X-ray Fluorescence Microscopy:

    • Visualize the distribution of zinc within cells at submicron resolution

    • Quantify zinc in different cellular compartments

    • Advantages: Spatial information, minimal sample preparation

    • Limitations: Specialized synchrotron facilities required

When studying ZntB specifically, combining these approaches with genetic manipulations (ΔzntB strains with controlled complementation) allows for determination of ZntB's specific contribution to zinc homeostasis against the background of other transport systems.

What are the key considerations for reconstituting ZntB into liposomes for functional studies?

Successful reconstitution requires attention to multiple factors:

  • Protein Preparation:

    • Ensure high purity (>95% by SDS-PAGE)

    • Verify pentameric assembly by size exclusion chromatography

    • Maintain protein stability during solubilization and purification

    • Consider including zinc during purification to stabilize the protein

  • Lipid Composition Optimization:

    ComponentConsiderations
    Phospholipid typesTest mixtures of POPC, POPE, POPG; consider including E. coli lipid extract
    Cholesterol content0-20% range to modulate membrane fluidity
    Charged lipidsInclude negatively charged lipids (POPG, cardiolipin) to mimic bacterial membrane
    Lipid-to-protein ratioOptimize for activity (typically 50:1 to 200:1 w/w)
  • Reconstitution Method Selection:

    • Detergent removal approaches:

      • Dialysis (gentle but time-consuming)

      • Bio-Beads adsorption (faster but less controlled)

      • Dilution (simple but may result in larger liposomes)

    • Direct incorporation during liposome formation:

      • Dehydration-rehydration

      • Freeze-thaw cycles

  • Orientation Control:

    • Asymmetric reconstitution for directional transport studies

    • Methods to verify orientation (protease accessibility, antibody binding)

    • Consider strategies to enrich for a specific orientation

  • Functional Validation:

    • Confirm proteoliposome size and homogeneity (DLS, electron microscopy)

    • Verify protein incorporation (freeze-fracture EM, density gradient centrifugation)

    • Establish baseline permeability (passive leakage controls)

    • Demonstrate transport activity with appropriate controls

For ZntB specifically, reconstitution should account for its pentameric structure and the need to maintain the native transmembrane topology. Creating liposomes with defined internal pH is crucial for testing the proposed proton-coupled transport mechanism .

How can researchers effectively compare the roles of ZntB, ZnuACB, and ZupT in E. coli zinc homeostasis?

A comprehensive comparative analysis requires:

  • Genetic Dissection Strategy:

    • Generate single, double, and triple knockout strains:

      • ΔzntB, ΔznuACB, ΔzupT

      • ΔzntB ΔznuACB, ΔzntB ΔzupT, ΔznuACB ΔzupT

      • ΔzntB ΔznuACB ΔzupT

    • Create complementation strains with controlled expression levels

    • Use fluorescent tags to monitor protein localization

  • Growth Phenotype Characterization:

    • Test growth under varying zinc concentrations (deficient to excess)

    • Challenge with zinc chelators (EDTA, TPEN)

    • Assess growth in different media (minimal, rich, host-mimicking)

    • Measure growth rates and yields under each condition

  • Transport Activity Measurements:

    • Direct ⁶⁵Zn²⁺ uptake assays in intact cells

    • Compare kinetic parameters (Km, Vmax) for each transporter

    • Determine the relative contribution of each system under different conditions

    • Assess impact of pH gradients on transport efficiency

  • Physiological Impact Assessment:

    • Measure activity of zinc-dependent enzymes in different genetic backgrounds

    • Assess resistance to various stressors (oxidative, pH, osmotic)

    • Evaluate biofilm formation and motility

    • Test virulence in appropriate models

  • Regulatory Network Analysis:

    • Monitor expression of each transporter in response to zinc availability

    • Identify regulatory cross-talk between systems

    • Map the zinc-responsive regulons (Zur, ZntR) in different genetic backgrounds

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.