Recombinant Escherichia coli O139:H28 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics

The recombinant UbiA protein is produced via heterologous expression in E. coli, typically fused with an N-terminal His-tag for purification and stability. Key attributes include:

PropertyDetails
SourceE. coli O139:H28 (strain E24377A/ETEC)
UniProt IDA7ZUR2
TagHis-tag (N-terminal)
Protein LengthFull-length (1–290 amino acids)
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
ReconstitutionLyophilized powder; reconstituted in sterile water (0.1–1.0 mg/mL)
Storage Conditions-20°C/-80°C (long-term); 4°C for short-term aliquots

Amino Acid Sequence
The full-length sequence includes conserved motifs critical for enzymatic activity:
MEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMR...
(Partial sequence; full sequence available in )

Functional Role in Ubiquinone Biosynthesis

UbiA is central to both aerobic and anaerobic ubiquinone (Q8) production:

Aerobic Pathway

  1. 4-HB Condensation: UbiA transfers an octaprenyl tail to 4-HB, forming the ubiquinone precursor .

  2. Downstream Modifications: Subsequent enzymes (e.g., UbiB, UbiE, UbiG) methylate and decarboxylate the precursor to yield Q8 .

Anaerobic Pathway

UbiA participates in an oxygen-independent pathway involving UbiT, UbiU, and UbiV proteins. This pathway is regulated by the Fnr transcription factor and supports nitrate respiration and pyrimidine biosynthesis .

Regulation

  • Catabolite Repression: UbiA expression is inhibited by glucose, mediated by the arcA regulatory gene .

  • Oxygen Sensing: Anaerobic conditions upregulate UbiA via Fnr-dependent promoters .

Inhibitors and Antimicrobial Targets

  • Dihydroxybenzisoxazole (DHB):

    • Dual Mechanism: Inhibits UbiA and acts as a prodrug, generating toxic intermediates .

    • Selectivity: Targets UbiA in E. coli, Enterobacter cloacae, and Klebsiella pneumoniae, with MICs of 0.25–0.5 µg/mL in minimal media .

    • Resistance: Overexpression of the AaeAB efflux pump reduces DHB efficacy .

Experimental Models

  • Mutant Strains: ΔubiA strains exhibit respiratory defects, rescued by COQ2 or anaerobic UbiUV-dependent pathways .

  • Enzymatic Assays: UbiA activity is monitored via 4-HB incorporation into lipid-soluble precursors .

Comparative Analysis with Homologs

FeatureUbiA (E. coli O139:H28)COQ2 (S. cerevisiae)
Substrate SpecificityOctaprenyl pyrophosphateHexaprenyl pyrophosphate
ProductUbiquinone-8 (Q8)Ubiquinone-6 (Q6)
Catalytic RoleAerobic/anaerobic Q8 biosynthesisAerobic Q6 biosynthesis
RegulationFnr, ArcAUnknown

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary based on purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, it is recommended to briefly centrifuge the vial prior to opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products can vary depending on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be finalized during the production process. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
ubiA; EcE24377A_4593; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Escherichia coli O139:H28 (strain E24377A / ETEC)
Target Names
ubiA
Target Protein Sequence
MEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVLISFLLVLTLNTMTIL LSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWA VAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGVLALMAIIGELNGLGWGYY WSILVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF
Uniprot No.

Target Background

Function
This enzyme catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. It mediates the second step in the final reaction sequence of ubiquinone-8 (UQ-8) biosynthesis. This step involves the condensation of the polyisoprenoid side chain with PHB, leading to the generation of the first membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is 4-hydroxybenzoate octaprenyltransferase (ubiA) and what is its role in E. coli metabolism?

4-hydroxybenzoate octaprenyltransferase (ubiA) is a critical enzyme in the ubiquinone (UQ) biosynthesis pathway of E. coli. It catalyzes the condensation reaction between 4-hydroxybenzoate (4HB) and a 40-carbon-long isoprenoid chain, representing one of the initial steps in ubiquinone production . The enzyme functions within a multi-step pathway that begins with the conversion of chorismate to 4-hydroxybenzoate by chorismate lyase (UbiC) . Ubiquinone serves as an essential electron and proton shuttle in respiratory chains, making ubiA vital for cellular energy metabolism, particularly under aerobic conditions . The enzyme plays a fundamental role in determining the efficiency of electron transport chain function, ultimately affecting growth characteristics and metabolic flexibility of E. coli strains.

How does the structure of ubiA protein relate to its functional activity?

The ubiA protein exhibits a molecular weight of approximately 60 kDa as confirmed by western blotting analysis . Its structure includes specific domains that facilitate interactions with both the hydrophilic 4-hydroxybenzoate substrate and the highly hydrophobic isoprenoid chain. The enzyme contains transmembrane regions that anchor it to the cytoplasmic membrane, where it can access both substrates efficiently. The active site architecture supports the precise positioning of both substrates to facilitate the condensation reaction. The protein's structure enables it to function within the larger ubiquinone biosynthesis complex, often referred to as the Ubi metabolon, which includes various other enzymes and assembly factors that coordinate the sequential modifications required for ubiquinone production .

What are the standard methods for cloning the ubiA gene from E. coli?

Standard cloning of the E. coli ubiA gene typically involves the following methodology:

  • Gene isolation from E. coli genomic DNA through PCR amplification

  • Design of oligonucleotide primer pairs incorporating appropriate restriction sites (e.g., XhoI and XbaI) at the 5' ends of forward and reverse primers, respectively

  • PCR amplification using high-fidelity DNA polymerase to minimize mutation introduction

  • Restriction digestion of both PCR product and target plasmid (e.g., pcDNA3) with appropriate enzymes

  • Ligation of the digested PCR product into the prepared plasmid vector

  • Transformation into competent E. coli cells

  • Selection of transformants on appropriate antibiotic-containing media

  • Confirmation of cloning through colony PCR, restriction digestion analysis, and DNA sequencing

This methodological approach typically yields recombinant plasmids with approximately 99% sequence identity to the original ubiA gene .

What expression systems are most effective for producing recombinant ubiA protein?

Based on research findings, several expression systems have proven effective for ubiA production:

  • Mammalian expression system: The pcDNA3 plasmid has been successfully used as an initial vector for ubiA cloning, providing a foundation for mammalian cell expression .

  • Insect cell expression system: The PUAST vector, derived from Drosophila expression systems, has demonstrated high efficiency for ubiA expression. When combined with S2 cells as a eukaryotic host, this system yields significant amounts of functional ubiA protein .

  • Bacterial expression systems: While not explicitly mentioned in the search results, E. coli-based expression systems using vectors like pET or pBAD series can be employed for homologous expression of bacterial ubiA.

The choice of expression system should be guided by research objectives - mammalian or insect cell systems may better preserve post-translational modifications, while bacterial systems typically offer higher protein yields but may require optimization for membrane protein expression.

How can researchers verify successful ubiA expression and determine protein purity?

Verification of ubiA expression and purity assessment can be accomplished through:

For recombinant ubiA produced in the PUAST vector system, western blotting typically reveals a singular purified protein band at approximately 60 kDa .

How do environmental conditions affect ubiA expression and activity in E. coli?

Environmental conditions significantly impact ubiA expression and activity in E. coli, particularly oxygen availability:

  • Aerobic conditions: Under aerobic conditions, ubiA functions as part of the classical ubiquinone biosynthesis pathway, working in concert with oxygen-dependent hydroxylases like UbiI, UbiH, and UbiF .

  • Anaerobic conditions: E. coli has evolved an alternative O₂-independent pathway for ubiquinone synthesis under anaerobic conditions. While ubiA remains essential in this pathway, it works with different protein partners (UbiU, UbiV, and UbiT) rather than the aerobic hydroxylases .

  • Transitional environments: During shifts between aerobic and anaerobic growth, regulatory systems like the Fnr transcriptional regulator modulate the expression of various components of the ubiquinone biosynthesis pathway, including potential effects on ubiA activity coordination .

Optimal expression and activity of ubiA thus requires careful consideration of oxygen availability, growth phase, and metabolic state of the bacterial culture.

What approaches can be used to study the interactions between ubiA and other proteins in the ubiquinone biosynthesis pathway?

Several methodological approaches can illuminate ubiA interactions within the ubiquinone biosynthesis pathway:

  • Co-immunoprecipitation: Using antibodies against ubiA to pull down associated proteins, followed by mass spectrometry identification.

  • Sequential Peptide Affinity (SPA) tagging: This approach has been successfully used to study protein interactions in E. coli UQ biosynthesis pathway components, as demonstrated with UbiU and UbiV proteins .

  • Bacterial two-hybrid systems: To detect specific binary interactions between ubiA and suspected partner proteins.

  • Crosslinking coupled with mass spectrometry: To capture transient interactions within the Ubi metabolon complex.

  • Genetic interaction studies: Analyzing synthetic lethality or synthetic sickness between ubiA and other genes can reveal functional relationships. Double knockout studies involving ubiA and other pathway components can provide insights into pathway organization .

These approaches collectively can map the protein interaction network surrounding ubiA and illuminate its role within the larger ubiquinone biosynthesis complex.

How can researchers quantitatively measure ubiA enzymatic activity?

Quantitative measurement of ubiA enzymatic activity can be accomplished through several approaches:

  • Radioisotope-based assays: Using ¹⁴C-labeled 4-hydroxybenzoate substrate to measure the formation of labeled isoprenylated products.

  • HPLC analysis: Monitoring the disappearance of 4-hydroxybenzoate substrate and appearance of the prenylated product.

  • LC-MS/MS methods: Providing high sensitivity detection of reaction products with structural confirmation.

  • Coupled enzyme assays: Where ubiA activity is linked to subsequent enzymatic reactions that generate measurable signals.

  • In vivo complementation assays: Testing the ability of recombinant ubiA to restore ubiquinone production in ubiA-deficient strains.

Standard assay conditions typically include:

  • Buffer composition: Typically Tris-HCl (pH 7.5-8.0) with MgCl₂

  • Substrate concentrations: 4-hydroxybenzoate (50-200 μM) and prenyl diphosphate (10-100 μM)

  • Detergent: To maintain protein solubility (e.g., 0.1% Triton X-100)

  • Temperature: Usually 30-37°C for E. coli enzyme

  • Reaction termination: By acidification or organic solvent addition

How does ubiA function differ between aerobic and anaerobic conditions in E. coli?

The function of ubiA shows important contextual differences between aerobic and anaerobic conditions:

  • Substrate availability: While ubiA catalyzes the same basic reaction under both conditions, the availability of substrates and cofactors may differ, affecting reaction kinetics.

  • Pathway partners: Under aerobic conditions, ubiA works with UbiB, UbiC, UbiD, UbiE, UbiG, UbiX, UbiI, UbiH, and UbiF in the traditional pathway . In contrast, under anaerobic conditions, ubiA functions with UbiB, UbiC, UbiD, UbiE, UbiG, UbiX, supplemented by the anaerobic-specific factors UbiT, UbiU, and UbiV .

  • Regulatory control: The Fnr transcriptional regulator, which senses oxygen levels, controls the expression of the anaerobic ubiquinone synthesis pathway components UbiT, UbiU, and UbiV . This suggests potential regulatory differences in how ubiA activity is coordinated under different oxygen tensions.

  • Metabolic context: Under anaerobic conditions, UQ synthesis supports specific anaerobic processes such as nitrate respiration and pyrimidine biosynthesis, potentially affecting the metabolic demand for ubiA activity .

These differences highlight the adaptability of the ubiquinone biosynthesis pathway to varying environmental conditions and the central role of ubiA within this adaptable system.

What are the genetic approaches for studying ubiA function in E. coli?

Several genetic approaches can be employed to study ubiA function:

  • Gene knockout studies: Creation of ubiA deletion strains using techniques like lambda Red recombination, P1 phage transduction, or CRISPR-Cas9 gene editing . The phenotypic consequences can then be assessed under various growth conditions.

  • Complementation analysis: Introduction of plasmid-borne ubiA variants into ubiA-deficient strains to assess functional restoration. This approach is valuable for structure-function studies of specific protein domains or residues.

  • Genetic suppressor screens: Identification of mutations that alleviate growth defects in ubiA-compromised strains to reveal functional relationships.

  • Conditional expression systems: Using regulated promoters (such as arabinose-inducible pBAD system) to control ubiA expression levels and timing .

  • Reporter gene fusions: Creation of transcriptional or translational fusions between ubiA and reporter genes (like GFP) to monitor expression patterns under different conditions .

  • Double knockout studies: Creating strains with mutations in both ubiA and other pathway components to assess genetic interactions and pathway organization, similar to studies conducted with other ubiquinone pathway components .

What is the role of ubiA in the context of E. coli respiratory adaptation?

UbiA plays a crucial role in E. coli respiratory adaptation through its contribution to ubiquinone biosynthesis:

  • Respiratory flexibility: By enabling ubiquinone production, ubiA contributes to E. coli's ability to utilize oxygen as a terminal electron acceptor during aerobic growth, while also supporting adaptation to changing oxygen levels .

  • Anaerobic respiration support: Anaerobic UQ synthesis, which requires ubiA, has been shown to be essential for nitrate respiration under anaerobic conditions . This highlights ubiA's importance in enabling respiratory diversity beyond oxygen utilization.

  • Metabolic integration: Beyond respiration, ubiquinone produced through the ubiA-dependent pathway supports other metabolic processes, including anaerobic pyrimidine biosynthesis .

  • Environmental adaptation: The ability to synthesize ubiquinone through both aerobic and anaerobic pathways (both requiring ubiA) contributes to E. coli's capacity to colonize diverse environments, including the mammalian gut where oxygen levels can fluctuate .

  • Transition management: The dual regulation systems for ubiquinone biosynthesis enable E. coli to rapidly shift between aerobic and anaerobic metabolism, with ubiA serving as a constant component across these transitions .

What are common challenges in purifying functional ubiA protein and how can they be addressed?

Purification of functional ubiA protein presents several challenges due to its membrane-associated nature:

ChallengePotential Solutions
Poor solubility- Use mild detergents (DDM, LDAO, etc.) for extraction
- Consider amphipol or nanodisc technologies for stabilization
- Optimize detergent-to-protein ratios
Low expression levels- Try different host strains optimized for membrane proteins
- Consider lower induction temperatures (16-20°C)
- Test different promoter systems
- Evaluate codon optimization
Protein instability- Include appropriate protease inhibitors
- Maintain consistent cold temperatures during purification
- Add stabilizing agents (glycerol, specific lipids)
Loss of activity- Reconstitute with appropriate lipids post-purification
- Include substrate analogs during purification
- Consider co-expression with chaperones
Aggregation- Use size exclusion chromatography to isolate monodisperse fractions
- Screen buffer conditions to improve homogeneity
- Consider fusion tags that enhance solubility

Western blotting techniques have been successfully employed to verify purified ubiA protein at the expected size of approximately 60 kDa . The use of eukaryotic expression systems, such as the PUAST vector in S2 cells, has been shown to improve protein synthesis yields for ubiA .

How can researchers optimize heterologous expression of ubiA for functional studies?

Optimization of heterologous ubiA expression requires attention to several parameters:

  • Vector selection:

    • For bacterial expression: pET series vectors with T7 promoter

    • For insect cells: PUAST vector has demonstrated success

    • For mammalian expression: pcDNA3 has been effectively used

  • Host cell considerations:

    • Bacterial hosts: C41(DE3) or C43(DE3) strains designed for membrane proteins

    • Insect cells: S2 cells have demonstrated good results for ubiA expression

    • Evaluate co-expression with chaperones to improve folding

  • Induction conditions:

    • Temperature: Lower temperatures (16-25°C) often improve membrane protein folding

    • Inducer concentration: Titrate IPTG, arabinose, or other inducers to optimize expression level

    • Duration: Extended expression periods at lower temperatures may improve yield of functional protein

  • Extraction and purification strategy:

    • Screen multiple detergents for optimal extraction efficiency

    • Consider affinity tags positioned to minimize interference with function

    • Include lipids during purification to maintain native-like environment

  • Functional verification:

    • Develop activity assays to confirm that the expressed protein retains catalytic function

    • Compare activity to native enzyme levels where possible

Experimental data indicates that the eukaryotic expression system provided by the PUAST vector can achieve enhanced protein synthesis of the ubiA gene .

What approaches can address contradictory results in ubiA functional studies?

When faced with contradictory results in ubiA studies, researchers should consider several methodological approaches:

  • Standardize experimental conditions:

    • Ensure consistent strain backgrounds across studies

    • Standardize growth conditions, particularly oxygen availability, which can dramatically affect ubiquinone biosynthesis pathway function

    • Document media composition precisely, as metabolic state affects respiratory chain components

  • Consider genetic background effects:

    • Verify the presence/absence of compensatory pathways

    • Confirm the status of other ubiquinone biosynthesis genes

    • Check for suppressor mutations that might arise during strain construction

  • Validate protein expression and activity:

    • Confirm ubiA expression levels through western blotting

    • Verify protein activity through in vitro assays

    • Assess ubiquinone production levels through HPLC or LC-MS

  • Control for environmental variables:

    • Monitor oxygen levels carefully, as they affect pathway choice between aerobic and anaerobic ubiquinone biosynthesis

    • Consider growth phase effects on enzyme activity

    • Account for differences between in vitro and in vivo conditions

  • Apply multiple complementary techniques:

    • Combine genetic, biochemical, and analytical approaches

    • Use both in vivo and in vitro systems to cross-validate findings

    • Consider structural studies to resolve mechanistic questions

What are promising areas for further research on ubiA and ubiquinone biosynthesis?

Several promising research directions for ubiA and ubiquinone biosynthesis merit exploration:

  • Structural biology approaches:

    • High-resolution structural determination of ubiA in complex with substrates

    • Cryo-EM studies of the complete Ubi metabolon to understand multi-enzyme organization

    • Structure-based design of specific inhibitors or activity modulators

  • Pathway regulation studies:

    • Further characterization of how oxygen-sensing through Fnr affects ubiquinone biosynthesis pathway composition

    • Investigation of additional regulatory mechanisms that coordinate aerobic and anaerobic pathways

    • Exploration of metabolic feedback mechanisms that modulate ubiA activity

  • Systems biology integration:

    • Multi-omics approaches to understand how ubiA activity integrates with broader cellular metabolism

    • Flux analysis to quantify the contribution of ubiA to ubiquinone production under varying conditions

    • Modeling of how ubiA activity affects respiratory chain function and energy production

  • Translational applications:

    • Exploration of ubiA as a potential antimicrobial target

    • Investigation of ubiA's role in bacterial adaptation during host colonization

    • Development of ubiA variants with enhanced catalytic properties

  • Comparative studies across species:

    • Analysis of how ubiA function differs across bacterial species with varying respiratory capabilities

    • Evaluation of host-specific adaptations in ubiA function in pathogenic versus commensal E. coli strains

How might advanced genetic techniques further our understanding of ubiA function?

Advanced genetic techniques offer powerful approaches to deepen our understanding of ubiA function:

  • CRISPR-Cas9 genome editing:

    • Precise introduction of point mutations to study structure-function relationships

    • Creation of conditional knockdown systems for essential genes in the pathway

    • Multiplexed editing to examine combinatorial effects with other pathway components

  • CRISPRi/CRISPRa systems:

    • Tunable repression or activation of ubiA and related genes

    • Temporal control of expression to study pathway dynamics

    • Genome-wide screens to identify novel genetic interactions

  • Synthetic biology approaches:

    • Reconstitution of minimal ubiquinone biosynthesis pathways

    • Creation of orthogonal pathways with modified substrate specificity

    • Engineering of regulatory circuits for controlled expression

  • In vivo biosensors:

    • Development of reporters for ubiquinone levels or ubiA activity

    • Real-time monitoring of pathway function during environmental transitions

    • Single-cell analysis of pathway heterogeneity

  • Transposon sequencing (Tn-seq):

    • Identification of genes that become essential in ubiA-compromised backgrounds

    • Discovery of novel factors affecting ubiquinone biosynthesis

    • Mapping of genetic interactions across varying environmental conditions

These advanced genetic approaches could extend beyond the current understanding of ubiA's role in both aerobic and anaerobic ubiquinone biosynthesis pathways, potentially revealing new functional relationships and regulatory mechanisms.

What are the most significant recent advances in understanding ubiA function?

Recent significant advances in understanding ubiA function include:

  • The discovery of parallel aerobic and anaerobic pathways for ubiquinone biosynthesis in E. coli, both requiring ubiA but with different downstream processing enzymes .

  • Identification of the UbiUVT system that enables O₂-independent ubiquinone synthesis under anaerobic conditions, providing new context for understanding ubiA's role across varying oxygen levels .

  • Elucidation of the Fnr-based regulatory mechanism that controls the expression of anaerobic ubiquinone biosynthesis components, suggesting sophisticated coordination of pathway variants .

  • Recognition of ubiquinone's importance beyond aerobic respiration, including its roles in nitrate respiration and pyrimidine biosynthesis under anaerobic conditions .

  • Development of improved expression systems for recombinant ubiA production, including the use of PUAST vector in S2 cells, facilitating more detailed biochemical studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.