The recombinant UbiA protein is produced via heterologous expression in E. coli, typically fused with an N-terminal His-tag for purification and stability. Key attributes include:
Amino Acid Sequence
The full-length sequence includes conserved motifs critical for enzymatic activity:
MEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMR...
(Partial sequence; full sequence available in )
UbiA is central to both aerobic and anaerobic ubiquinone (Q8) production:
4-HB Condensation: UbiA transfers an octaprenyl tail to 4-HB, forming the ubiquinone precursor .
Downstream Modifications: Subsequent enzymes (e.g., UbiB, UbiE, UbiG) methylate and decarboxylate the precursor to yield Q8 .
UbiA participates in an oxygen-independent pathway involving UbiT, UbiU, and UbiV proteins. This pathway is regulated by the Fnr transcription factor and supports nitrate respiration and pyrimidine biosynthesis .
Catabolite Repression: UbiA expression is inhibited by glucose, mediated by the arcA regulatory gene .
Oxygen Sensing: Anaerobic conditions upregulate UbiA via Fnr-dependent promoters .
Dihydroxybenzisoxazole (DHB):
Mutant Strains: ΔubiA strains exhibit respiratory defects, rescued by COQ2 or anaerobic UbiUV-dependent pathways .
Enzymatic Assays: UbiA activity is monitored via 4-HB incorporation into lipid-soluble precursors .
| Feature | UbiA (E. coli O139:H28) | COQ2 (S. cerevisiae) |
|---|---|---|
| Substrate Specificity | Octaprenyl pyrophosphate | Hexaprenyl pyrophosphate |
| Product | Ubiquinone-8 (Q8) | Ubiquinone-6 (Q6) |
| Catalytic Role | Aerobic/anaerobic Q8 biosynthesis | Aerobic Q6 biosynthesis |
| Regulation | Fnr, ArcA | Unknown |
KEGG: ecw:EcE24377A_4593
4-hydroxybenzoate octaprenyltransferase (ubiA) is a critical enzyme in the ubiquinone (UQ) biosynthesis pathway of E. coli. It catalyzes the condensation reaction between 4-hydroxybenzoate (4HB) and a 40-carbon-long isoprenoid chain, representing one of the initial steps in ubiquinone production . The enzyme functions within a multi-step pathway that begins with the conversion of chorismate to 4-hydroxybenzoate by chorismate lyase (UbiC) . Ubiquinone serves as an essential electron and proton shuttle in respiratory chains, making ubiA vital for cellular energy metabolism, particularly under aerobic conditions . The enzyme plays a fundamental role in determining the efficiency of electron transport chain function, ultimately affecting growth characteristics and metabolic flexibility of E. coli strains.
The ubiA protein exhibits a molecular weight of approximately 60 kDa as confirmed by western blotting analysis . Its structure includes specific domains that facilitate interactions with both the hydrophilic 4-hydroxybenzoate substrate and the highly hydrophobic isoprenoid chain. The enzyme contains transmembrane regions that anchor it to the cytoplasmic membrane, where it can access both substrates efficiently. The active site architecture supports the precise positioning of both substrates to facilitate the condensation reaction. The protein's structure enables it to function within the larger ubiquinone biosynthesis complex, often referred to as the Ubi metabolon, which includes various other enzymes and assembly factors that coordinate the sequential modifications required for ubiquinone production .
Standard cloning of the E. coli ubiA gene typically involves the following methodology:
Gene isolation from E. coli genomic DNA through PCR amplification
Design of oligonucleotide primer pairs incorporating appropriate restriction sites (e.g., XhoI and XbaI) at the 5' ends of forward and reverse primers, respectively
PCR amplification using high-fidelity DNA polymerase to minimize mutation introduction
Restriction digestion of both PCR product and target plasmid (e.g., pcDNA3) with appropriate enzymes
Ligation of the digested PCR product into the prepared plasmid vector
Transformation into competent E. coli cells
Selection of transformants on appropriate antibiotic-containing media
Confirmation of cloning through colony PCR, restriction digestion analysis, and DNA sequencing
This methodological approach typically yields recombinant plasmids with approximately 99% sequence identity to the original ubiA gene .
Based on research findings, several expression systems have proven effective for ubiA production:
Mammalian expression system: The pcDNA3 plasmid has been successfully used as an initial vector for ubiA cloning, providing a foundation for mammalian cell expression .
Insect cell expression system: The PUAST vector, derived from Drosophila expression systems, has demonstrated high efficiency for ubiA expression. When combined with S2 cells as a eukaryotic host, this system yields significant amounts of functional ubiA protein .
Bacterial expression systems: While not explicitly mentioned in the search results, E. coli-based expression systems using vectors like pET or pBAD series can be employed for homologous expression of bacterial ubiA.
The choice of expression system should be guided by research objectives - mammalian or insect cell systems may better preserve post-translational modifications, while bacterial systems typically offer higher protein yields but may require optimization for membrane protein expression.
Verification of ubiA expression and purity assessment can be accomplished through:
For recombinant ubiA produced in the PUAST vector system, western blotting typically reveals a singular purified protein band at approximately 60 kDa .
Environmental conditions significantly impact ubiA expression and activity in E. coli, particularly oxygen availability:
Aerobic conditions: Under aerobic conditions, ubiA functions as part of the classical ubiquinone biosynthesis pathway, working in concert with oxygen-dependent hydroxylases like UbiI, UbiH, and UbiF .
Anaerobic conditions: E. coli has evolved an alternative O₂-independent pathway for ubiquinone synthesis under anaerobic conditions. While ubiA remains essential in this pathway, it works with different protein partners (UbiU, UbiV, and UbiT) rather than the aerobic hydroxylases .
Transitional environments: During shifts between aerobic and anaerobic growth, regulatory systems like the Fnr transcriptional regulator modulate the expression of various components of the ubiquinone biosynthesis pathway, including potential effects on ubiA activity coordination .
Optimal expression and activity of ubiA thus requires careful consideration of oxygen availability, growth phase, and metabolic state of the bacterial culture.
Several methodological approaches can illuminate ubiA interactions within the ubiquinone biosynthesis pathway:
Co-immunoprecipitation: Using antibodies against ubiA to pull down associated proteins, followed by mass spectrometry identification.
Sequential Peptide Affinity (SPA) tagging: This approach has been successfully used to study protein interactions in E. coli UQ biosynthesis pathway components, as demonstrated with UbiU and UbiV proteins .
Bacterial two-hybrid systems: To detect specific binary interactions between ubiA and suspected partner proteins.
Crosslinking coupled with mass spectrometry: To capture transient interactions within the Ubi metabolon complex.
Genetic interaction studies: Analyzing synthetic lethality or synthetic sickness between ubiA and other genes can reveal functional relationships. Double knockout studies involving ubiA and other pathway components can provide insights into pathway organization .
These approaches collectively can map the protein interaction network surrounding ubiA and illuminate its role within the larger ubiquinone biosynthesis complex.
Quantitative measurement of ubiA enzymatic activity can be accomplished through several approaches:
Radioisotope-based assays: Using ¹⁴C-labeled 4-hydroxybenzoate substrate to measure the formation of labeled isoprenylated products.
HPLC analysis: Monitoring the disappearance of 4-hydroxybenzoate substrate and appearance of the prenylated product.
LC-MS/MS methods: Providing high sensitivity detection of reaction products with structural confirmation.
Coupled enzyme assays: Where ubiA activity is linked to subsequent enzymatic reactions that generate measurable signals.
In vivo complementation assays: Testing the ability of recombinant ubiA to restore ubiquinone production in ubiA-deficient strains.
Standard assay conditions typically include:
Buffer composition: Typically Tris-HCl (pH 7.5-8.0) with MgCl₂
Substrate concentrations: 4-hydroxybenzoate (50-200 μM) and prenyl diphosphate (10-100 μM)
Detergent: To maintain protein solubility (e.g., 0.1% Triton X-100)
Temperature: Usually 30-37°C for E. coli enzyme
Reaction termination: By acidification or organic solvent addition
The function of ubiA shows important contextual differences between aerobic and anaerobic conditions:
Substrate availability: While ubiA catalyzes the same basic reaction under both conditions, the availability of substrates and cofactors may differ, affecting reaction kinetics.
Pathway partners: Under aerobic conditions, ubiA works with UbiB, UbiC, UbiD, UbiE, UbiG, UbiX, UbiI, UbiH, and UbiF in the traditional pathway . In contrast, under anaerobic conditions, ubiA functions with UbiB, UbiC, UbiD, UbiE, UbiG, UbiX, supplemented by the anaerobic-specific factors UbiT, UbiU, and UbiV .
Regulatory control: The Fnr transcriptional regulator, which senses oxygen levels, controls the expression of the anaerobic ubiquinone synthesis pathway components UbiT, UbiU, and UbiV . This suggests potential regulatory differences in how ubiA activity is coordinated under different oxygen tensions.
Metabolic context: Under anaerobic conditions, UQ synthesis supports specific anaerobic processes such as nitrate respiration and pyrimidine biosynthesis, potentially affecting the metabolic demand for ubiA activity .
These differences highlight the adaptability of the ubiquinone biosynthesis pathway to varying environmental conditions and the central role of ubiA within this adaptable system.
Several genetic approaches can be employed to study ubiA function:
Gene knockout studies: Creation of ubiA deletion strains using techniques like lambda Red recombination, P1 phage transduction, or CRISPR-Cas9 gene editing . The phenotypic consequences can then be assessed under various growth conditions.
Complementation analysis: Introduction of plasmid-borne ubiA variants into ubiA-deficient strains to assess functional restoration. This approach is valuable for structure-function studies of specific protein domains or residues.
Genetic suppressor screens: Identification of mutations that alleviate growth defects in ubiA-compromised strains to reveal functional relationships.
Conditional expression systems: Using regulated promoters (such as arabinose-inducible pBAD system) to control ubiA expression levels and timing .
Reporter gene fusions: Creation of transcriptional or translational fusions between ubiA and reporter genes (like GFP) to monitor expression patterns under different conditions .
Double knockout studies: Creating strains with mutations in both ubiA and other pathway components to assess genetic interactions and pathway organization, similar to studies conducted with other ubiquinone pathway components .
UbiA plays a crucial role in E. coli respiratory adaptation through its contribution to ubiquinone biosynthesis:
Respiratory flexibility: By enabling ubiquinone production, ubiA contributes to E. coli's ability to utilize oxygen as a terminal electron acceptor during aerobic growth, while also supporting adaptation to changing oxygen levels .
Anaerobic respiration support: Anaerobic UQ synthesis, which requires ubiA, has been shown to be essential for nitrate respiration under anaerobic conditions . This highlights ubiA's importance in enabling respiratory diversity beyond oxygen utilization.
Metabolic integration: Beyond respiration, ubiquinone produced through the ubiA-dependent pathway supports other metabolic processes, including anaerobic pyrimidine biosynthesis .
Environmental adaptation: The ability to synthesize ubiquinone through both aerobic and anaerobic pathways (both requiring ubiA) contributes to E. coli's capacity to colonize diverse environments, including the mammalian gut where oxygen levels can fluctuate .
Transition management: The dual regulation systems for ubiquinone biosynthesis enable E. coli to rapidly shift between aerobic and anaerobic metabolism, with ubiA serving as a constant component across these transitions .
Purification of functional ubiA protein presents several challenges due to its membrane-associated nature:
| Challenge | Potential Solutions |
|---|---|
| Poor solubility | - Use mild detergents (DDM, LDAO, etc.) for extraction - Consider amphipol or nanodisc technologies for stabilization - Optimize detergent-to-protein ratios |
| Low expression levels | - Try different host strains optimized for membrane proteins - Consider lower induction temperatures (16-20°C) - Test different promoter systems - Evaluate codon optimization |
| Protein instability | - Include appropriate protease inhibitors - Maintain consistent cold temperatures during purification - Add stabilizing agents (glycerol, specific lipids) |
| Loss of activity | - Reconstitute with appropriate lipids post-purification - Include substrate analogs during purification - Consider co-expression with chaperones |
| Aggregation | - Use size exclusion chromatography to isolate monodisperse fractions - Screen buffer conditions to improve homogeneity - Consider fusion tags that enhance solubility |
Western blotting techniques have been successfully employed to verify purified ubiA protein at the expected size of approximately 60 kDa . The use of eukaryotic expression systems, such as the PUAST vector in S2 cells, has been shown to improve protein synthesis yields for ubiA .
Optimization of heterologous ubiA expression requires attention to several parameters:
Vector selection:
Host cell considerations:
Induction conditions:
Temperature: Lower temperatures (16-25°C) often improve membrane protein folding
Inducer concentration: Titrate IPTG, arabinose, or other inducers to optimize expression level
Duration: Extended expression periods at lower temperatures may improve yield of functional protein
Extraction and purification strategy:
Screen multiple detergents for optimal extraction efficiency
Consider affinity tags positioned to minimize interference with function
Include lipids during purification to maintain native-like environment
Functional verification:
Develop activity assays to confirm that the expressed protein retains catalytic function
Compare activity to native enzyme levels where possible
Experimental data indicates that the eukaryotic expression system provided by the PUAST vector can achieve enhanced protein synthesis of the ubiA gene .
When faced with contradictory results in ubiA studies, researchers should consider several methodological approaches:
Standardize experimental conditions:
Consider genetic background effects:
Verify the presence/absence of compensatory pathways
Confirm the status of other ubiquinone biosynthesis genes
Check for suppressor mutations that might arise during strain construction
Validate protein expression and activity:
Control for environmental variables:
Apply multiple complementary techniques:
Combine genetic, biochemical, and analytical approaches
Use both in vivo and in vitro systems to cross-validate findings
Consider structural studies to resolve mechanistic questions
Several promising research directions for ubiA and ubiquinone biosynthesis merit exploration:
Structural biology approaches:
High-resolution structural determination of ubiA in complex with substrates
Cryo-EM studies of the complete Ubi metabolon to understand multi-enzyme organization
Structure-based design of specific inhibitors or activity modulators
Pathway regulation studies:
Systems biology integration:
Multi-omics approaches to understand how ubiA activity integrates with broader cellular metabolism
Flux analysis to quantify the contribution of ubiA to ubiquinone production under varying conditions
Modeling of how ubiA activity affects respiratory chain function and energy production
Translational applications:
Comparative studies across species:
Analysis of how ubiA function differs across bacterial species with varying respiratory capabilities
Evaluation of host-specific adaptations in ubiA function in pathogenic versus commensal E. coli strains
Advanced genetic techniques offer powerful approaches to deepen our understanding of ubiA function:
CRISPR-Cas9 genome editing:
Precise introduction of point mutations to study structure-function relationships
Creation of conditional knockdown systems for essential genes in the pathway
Multiplexed editing to examine combinatorial effects with other pathway components
CRISPRi/CRISPRa systems:
Tunable repression or activation of ubiA and related genes
Temporal control of expression to study pathway dynamics
Genome-wide screens to identify novel genetic interactions
Synthetic biology approaches:
Reconstitution of minimal ubiquinone biosynthesis pathways
Creation of orthogonal pathways with modified substrate specificity
Engineering of regulatory circuits for controlled expression
In vivo biosensors:
Development of reporters for ubiquinone levels or ubiA activity
Real-time monitoring of pathway function during environmental transitions
Single-cell analysis of pathway heterogeneity
Transposon sequencing (Tn-seq):
Identification of genes that become essential in ubiA-compromised backgrounds
Discovery of novel factors affecting ubiquinone biosynthesis
Mapping of genetic interactions across varying environmental conditions
These advanced genetic approaches could extend beyond the current understanding of ubiA's role in both aerobic and anaerobic ubiquinone biosynthesis pathways, potentially revealing new functional relationships and regulatory mechanisms.
Recent significant advances in understanding ubiA function include:
The discovery of parallel aerobic and anaerobic pathways for ubiquinone biosynthesis in E. coli, both requiring ubiA but with different downstream processing enzymes .
Identification of the UbiUVT system that enables O₂-independent ubiquinone synthesis under anaerobic conditions, providing new context for understanding ubiA's role across varying oxygen levels .
Elucidation of the Fnr-based regulatory mechanism that controls the expression of anaerobic ubiquinone biosynthesis components, suggesting sophisticated coordination of pathway variants .
Recognition of ubiquinone's importance beyond aerobic respiration, including its roles in nitrate respiration and pyrimidine biosynthesis under anaerobic conditions .
Development of improved expression systems for recombinant ubiA production, including the use of PUAST vector in S2 cells, facilitating more detailed biochemical studies .