Recombinant Escherichia coli O139:H28 Bifunctional protein aas (aas)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
aas; EcE24377A_3156; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Long-chain-fatty-acid--[acyl-carrier-protein] ligase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-719
Protein Length
full length protein
Species
Escherichia coli O139:H28 (strain E24377A / ETEC)
Target Names
aas
Target Protein Sequence
MLFSFFRNLCRVLYRVRVTGDTQALKGERVLITPNHVSFIDGILLGLFLPVRPVFAVYTS ISQQWYMRWLKSFIDFVPLDPTQPMAIKHLVRLVEQGRPVVIFPEGRITTTGSLMKIYDG AGFVAAKSGATVIPVRIEGAELTHFSRLKGLVKRRLFPQITLHILPPTQVAMPDAPRARD RRKIAGEMLHQIMMEARMAVRPRETLYESLLSAMYRFGAGKKCVEDVNFTPDSYRKLLTK TLFVGRILEKYSVEGERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITA AEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTTADKVWIFAHLLMPRLAQV KQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTTNDRFMSALPLFHSFG LTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGM DARLLSVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYDTGDIVR FDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGEALVLFT TDNELTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGKPDFVTLKSWVDEAEQHDE
Uniprot No.

Target Background

Function
This protein plays a crucial role in lysophospholipid acylation. It catalyzes the transfer of fatty acids to the 1-position of lysophospholipids via an enzyme-bound acyl-ACP intermediate, requiring ATP and magnesium ions. Its physiological function is to regenerate phosphatidylethanolamine from 2-acyl-glycero-3-phosphoethanolamine (2-acyl-GPE), a byproduct of transacylation reactions or phospholipase A1 degradation.
Database Links
Protein Families
2-acyl-GPE acetyltransferase family; ATP-dependent AMP-binding enzyme family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the aas gene in Escherichia coli and what functions does it encode?

The aas gene in Escherichia coli encodes a bifunctional protein that performs two distinct enzymatic activities: 2-acylglycerophosphoethanolamine (2-acyl-GPE) acyltransferase and acyl-acyl carrier protein (acyl-ACP) synthetase. This dual functionality allows the protein to play a critical role in phospholipid metabolism and fatty acid incorporation into bacterial membranes. The gene product has been verified as the rate-limiting enzyme in the uptake and incorporation of exogenous 2-acyllysophospholipids into the bacterial membrane system .

What is the molecular structure and size of the aas gene and its protein product?

The aas gene consists of a single open reading frame of 2,157 base pairs, which encodes a protein with a predicted molecular weight of 80.6 kDa. When expressed, the protein demonstrates an apparent molecular mass of approximately 81 kDa when analyzed via SDS-PAGE. The gene's complete DNA sequence has been determined, establishing its precise genetic architecture . Structural analyses have identified three domains of high sequence similarity with mammalian, yeast, and bacterial long-chain acyl-coenzyme A synthetases, which are postulated to form the critical acyl-AMP binding pocket essential for catalytic activity .

Where is the aas gene located in the E. coli chromosome?

The aas gene is located at the 61.2-minute position on the Escherichia coli chromosome. DNA sequencing and genetic mapping of the region between aas and the galR gene have established the clockwise gene order as aas-orf-galR-lysA-lysR-orf-araE. This chromosomal organization provides important context for understanding potential regulatory relationships and genetic interactions that may influence aas expression and function .

What experimental approaches are recommended for studying aas gene function in E. coli O139:H28?

For investigating aas gene function in E. coli O139:H28, several methodological approaches can be employed:

  • Gene Cloning and Sequencing: Using PCR amplification with strain-specific primers, followed by DNA sequencing to verify the exact genetic structure in the O139:H28 serotype.

  • Expression Analysis: Quantitative RT-PCR and RNA-seq to measure aas gene expression levels under different growth conditions, particularly those affecting membrane composition.

  • Protein Activity Assays: In vitro enzyme assays measuring both 2-acyl-GPE acyltransferase and acyl-ACP synthetase activities using purified recombinant protein.

  • Gene Knockout Studies: Creation of aas deletion mutants using CRISPR-Cas9 or homologous recombination techniques, followed by comparative phenotypic analysis.

  • Complementation Studies: Reintroduction of functional aas gene variants to verify phenotype restoration in knockout strains.

For addressing potential contradictions in experimental outcomes, systematic comparison of methodologies and experimental conditions is essential, as inconsistencies often arise from variations in assay conditions or strain-specific differences .

How can recombinant aas protein be expressed and purified for functional studies?

The expression and purification of recombinant aas protein can be achieved through the following methodological workflow:

Expression System Selection:

  • Bacterial expression using E. coli BL21(DE3) with a pET-based vector containing the aas gene under control of a T7 promoter

  • Alternative systems include yeast expression (P. pastoris) for potential glycosylated variants

Expression Protocol:

  • Transform expression vector into appropriate host strain

  • Culture in LB or auto-induction media at optimal temperature (typically 18-25°C for better solubility)

  • Induce with IPTG (0.1-0.5 mM) when bacterial culture reaches OD600 of 0.6-0.8

  • Continue expression for 4-16 hours depending on protein stability

Purification Strategy:

  • Cell lysis using sonication or French press in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM DTT

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged protein

  • Ion exchange chromatography as a secondary purification step

  • Size exclusion chromatography for final polishing and buffer exchange

Activity Verification:

  • Enzymatic assays measuring both acyltransferase and synthetase activities

  • Circular dichroism to verify proper protein folding

  • Thermal shift assays to assess protein stability

The purified protein can be stored at -80°C in buffer containing 20% glycerol to maintain activity for subsequent functional studies.

What analytical methods are most effective for studying aas enzyme kinetics?

For comprehensive kinetic analysis of the bifunctional aas protein, the following analytical approaches are recommended:

Spectrophotometric Assays:

  • Continuous monitoring of acyl-ACP synthetase activity through NADH-coupled assays

  • Measurement of 2-acyl-GPE acyltransferase activity via coupled enzyme reactions

Radiometric Assays:

  • 14C-labeled fatty acid incorporation assays for direct measurement of acyl-ACP formation

  • 14C-labeled lysophospholipid assays for measuring acyltransferase activity

Mass Spectrometry-Based Approaches:

  • LC-MS/MS for direct quantification of reaction products

  • Protein-substrate interaction analysis using hydrogen-deuterium exchange mass spectrometry

Isothermal Titration Calorimetry (ITC):

  • Direct measurement of binding thermodynamics between aas and substrates/cofactors

For kinetic parameter determination, initial velocity experiments at varying substrate concentrations should be performed to establish Km, Vmax, and kcat values for both enzymatic activities. This dual-function analysis is critical for understanding how the two activities may be regulated or coordinated within the same protein structure .

How can contradictory findings about aas protein function be reconciled in the literature?

Reconciling contradictory findings regarding aas protein function requires a systematic approach to contradiction detection and resolution in scientific literature. Consider implementing the following methodology:

  • Systematic Literature Review:

    • Create a structured database of published findings on aas protein

    • Catalog experimental conditions, strain variations, and methodological details

    • Identify specific points of contradiction using clinical contradiction detection frameworks

  • Meta-Analysis Approach:

    • Apply statistical methods to evaluate the strength of evidence for conflicting claims

    • Weight findings based on methodological rigor and reproducibility

    • Identify potential moderator variables that might explain discrepancies

  • Experimental Validation:

    • Design experiments specifically targeting contradictory findings

    • Standardize experimental conditions across different assays

    • Include positive and negative controls based on consistent findings

  • Natural Language Processing Tools:

    • Utilize contradiction detection algorithms to systematically identify conflicting claims in the literature

    • Apply ontology-driven methodologies similar to those used in clinical contradiction detection

The contradictions in aas research findings often stem from differences in experimental conditions, strain variations, or assay specificities. Recent advances in clinical contradiction detection through deep learning models can be applied to systematically identify and categorize contradictions in the literature .

Potential Source of ContradictionDetection MethodResolution Approach
Strain variation (O139:H28 vs. other)Genomic comparisonDirect experimental comparison under identical conditions
Assay methodology differencesProtocol alignment analysisStandardized protocol development
Growth condition variationsMeta-analysis of experimental conditionsSystematic testing across condition spectrum
Substrate specificity discrepanciesEnzyme kinetic comparisonComprehensive substrate panel testing

What expression systems are optimal for producing functional recombinant aas protein?

When selecting an expression system for the recombinant production of functional aas protein, several factors must be considered to ensure proper folding, post-translational modifications, and enzymatic activity:

E. coli Expression Systems:

  • Advantages: Fast growth, high yields, genetic tractability

  • Recommended strains: BL21(DE3), Rosetta 2(DE3) for rare codon optimization, Origami for disulfide bond formation

  • Vector considerations: pET vectors with T7 promoter systems offer tight regulation and high expression

  • Expression conditions: Lower temperatures (16-25°C) often improve solubility and proper folding

Yeast Expression Systems:

  • Pichia pastoris offers benefits for membrane-associated proteins like aas

  • Post-translational processing more similar to native eukaryotic modifications

  • Inducible promoters allow controlled expression

Mammalian Cell Expression:

  • Provides most native-like environment for complex proteins

  • HEK293 or CHO cells commonly used for research-scale production

  • Transient transfection for screening, stable cell lines for consistent production

What are the critical parameters for assaying aas protein activity in vitro?

Accurate measurement of aas protein's dual enzymatic activities requires careful consideration of several critical parameters:

Essential Assay Components:

  • Buffer composition: Typically 50 mM Tris-HCl or HEPES (pH 7.5-8.0)

  • Divalent cations: 5-10 mM MgCl₂ is required for both activities

  • ATP concentration: 2-5 mM for acyl-ACP synthetase activity

  • Reducing agents: 1-5 mM DTT or 2-ME to maintain cysteine residues

  • Substrates: Fatty acids (C14-C18) and 2-acyl-GPE at appropriate concentrations

Critical Control Parameters:

  • Temperature: Activity typically measured at 30-37°C

  • pH optimization: Activity profile across pH 6.5-9.0 should be established

  • Enzyme concentration: Linear range of activity must be determined

  • Incubation time: Establish linear range of product formation

  • Substrate saturation: Ensure substrate concentrations exceed 5×Km

Potential Interfering Factors:

  • Detergent concentration: Critical for solubilizing lipid substrates but may inhibit at high concentrations

  • Metal ion contamination: EDTA controls may be necessary

  • Product inhibition: Initial rate measurements recommended

Data Analysis Considerations:

  • Appropriate controls: Heat-inactivated enzyme, no-substrate controls

  • Standard curves: For each product being measured

  • Statistical analysis: Minimum of triplicate measurements

These parameters should be systematically optimized when establishing new assay conditions or comparing activities across different experimental setups to minimize contradictions in reported activities .

What genome editing approaches are most effective for studying aas gene function in vivo?

For in vivo functional studies of the aas gene in E. coli O139:H28, several genome editing approaches can be employed, each with specific advantages for different research questions:

CRISPR-Cas9 Based Methods:

  • Enables precise gene knockout, point mutations, or insertions

  • Design considerations: sgRNA with minimal off-target effects, PAM site availability

  • Delivery method: Plasmid-based systems with temperature-sensitive replication

  • Verification: Sanger sequencing and phenotypic confirmation

λ Red Recombineering:

  • Traditional approach for gene replacement in E. coli

  • Required components: pKD46 (λ Red) and pCP20 (FLP recombinase)

  • Selection markers: Kanamycin, chloramphenicol, or tetracycline resistance cassettes

  • Marker removal: FRT sites for scarless modifications

Transposon Mutagenesis:

  • For genome-wide screening of genetic interactions with aas

  • Systems: Tn5, Tn10, or mariner transposons

  • Analysis: Next-generation sequencing for insertion site mapping

  • Applications: Identification of synthetic lethal interactions

Complementation Analysis Workflow:

  • Generate clean aas deletion mutant

  • Create expression vectors with wild-type and mutant variants

  • Transform into deletion background

  • Assess phenotype restoration through:

    • Growth curves in minimal media

    • Membrane phospholipid composition analysis

    • Exogenous fatty acid incorporation assays

For comprehensive functional characterization, combining multiple approaches is recommended. For example, CRISPR-based point mutations of specific catalytic residues can dissect the importance of each enzymatic function independently, while transposon mutagenesis can identify novel genetic interactions.

How should contradictory data about aas protein function be evaluated and resolved?

When faced with contradictory data regarding aas protein function, a structured analytical approach should be implemented:

Systematic Contradiction Assessment:

  • Categorize contradictions based on nature (methodology, results, or interpretation)

  • Apply clinical contradiction detection frameworks to identify specific points of inconsistency

  • Evaluate the strength of evidence supporting each contradictory claim

Resolution Strategy Workflow:

  • Methodological Comparison:

    • Analyze experimental conditions (pH, temperature, buffer composition)

    • Examine protein preparation methods (expression system, purification protocol)

    • Evaluate assay sensitivities and limitations

  • Direct Experimental Replication:

    • Design experiments specifically addressing contradictory points

    • Include comprehensive controls and blinds where appropriate

    • Perform side-by-side comparisons using standardized protocols

  • Statistical Re-analysis:

    • Apply appropriate statistical methods to raw data when available

    • Conduct meta-analysis across multiple studies

    • Calculate effect sizes to quantify practical significance

  • Reconciliation Framework:

    • Consider whether contradictions might represent context-dependent effects

    • Develop unified models incorporating conditional factors

    • Test predictions of unified models with new experiments

Recent advances in clinical contradiction detection through artificial intelligence can be leveraged to systematically identify patterns in contradictory literature. Models fine-tuned on clinical datasets have shown improvement in detecting contradictions between naturally occurring sentences in scientific literature .

What bioinformatic tools are most useful for analyzing aas protein structure and function?

For comprehensive bioinformatic analysis of the aas protein, researchers should utilize the following tools and approaches:

Sequence Analysis Tools:

  • BLAST/PSI-BLAST: For homology identification and evolutionary relationships

  • MUSCLE/CLUSTAL: Multiple sequence alignment to identify conserved domains

  • HMMER: Profile hidden Markov models for remote homology detection

  • ConSurf: Conservation analysis for functional residue prediction

Protein Structure Analysis:

  • AlphaFold2/RoseTTAFold: AI-based structure prediction

  • PyMOL/UCSF Chimera: Visualization and analysis of predicted structures

  • CASTp: Binding pocket and active site prediction

  • CAVER: Tunnel and channel identification for substrate access

Functional Domain Analysis:

  • InterProScan: Integrated protein domain and functional site prediction

  • SUPERFAMILY: Structural classification of protein domains

  • PROSITE: Functional motif identification

Protein-Protein Interaction Prediction:

  • STRING: Functional protein association networks

  • HADDOCK: Molecular docking for complex formation modeling

  • PRISM: Protein-protein interaction prediction

Based on the sequence analysis of the aas gene, three domains of high similarity with long chain acyl-coenzyme A synthetases have been identified, which are postulated to form the acyl-AMP binding pocket critical for function . Further structural analysis can build on this foundation to develop a comprehensive model of how the protein's bifunctional activities are coordinated at the molecular level.

What are the key considerations for experimental design when studying aas protein regulation?

When investigating the regulation of aas protein expression and activity, a comprehensive experimental design should address multiple levels of regulation:

Transcriptional Regulation Studies:

  • Promoter analysis using reporter gene fusions (lacZ, GFP)

  • ChIP-seq to identify transcription factor binding sites

  • RNA-seq under various growth conditions to identify regulatory networks

  • CRISPR interference (CRISPRi) for targeted repression studies

Post-transcriptional Regulation:

  • mRNA stability assays using rifampicin chase experiments

  • Northern blotting or qRT-PCR for mRNA level quantification

  • Translational efficiency analysis using ribosome profiling

  • sRNA interaction studies using MS2-affinity purification

Post-translational Regulation:

  • Phosphorylation site mapping using mass spectrometry

  • Activity assays in the presence of various metabolites

  • Protein stability studies using pulse-chase experiments

  • Subcellular localization analysis using fluorescent protein fusions

Environmental Response Profiling:

  • Systematic evaluation of aas expression under:

    • Different carbon sources

    • Membrane stress conditions

    • Fatty acid availability variations

    • Phospholipid precursor limitations

Experimental Design Matrix:

Regulatory LevelTechniqueControl/ReferenceData Analysis Approach
TranscriptionalRNA-seqWild-type in standard mediaDifferential expression analysis
TranscriptionalPromoter-reporter fusionsPromoterless vectorTime-course activity measurements
Post-translationalEnzyme activity assaysHeat-inactivated enzymeMichaelis-Menten kinetics
EnvironmentalMembrane composition analysisStandard growth conditionsLipidomics profiling

Particular attention should be given to the potential coordination between the two enzymatic activities of aas under different cellular states, as this bifunctionality suggests sophisticated regulatory mechanisms that may respond to membrane composition and fatty acid availability .

How can the bifunctional nature of aas protein be leveraged for metabolic engineering applications?

The bifunctional nature of the aas protein, with its dual 2-acyl-GPE acyltransferase and acyl-ACP synthetase activities, presents unique opportunities for metabolic engineering applications:

Membrane Phospholipid Engineering:

  • Overexpression of aas can enhance incorporation of exogenous fatty acids into membrane phospholipids, as demonstrated in strains harboring multiple copies of the aas gene

  • This capability could be exploited to introduce novel fatty acids with desirable properties into bacterial membranes

  • Potential applications include enhanced stress tolerance, biofuel production, and biocontainment strategies

Fatty Acid Incorporation Pathway Enhancement:

  • The acyl-ACP synthetase activity creates a direct link between exogenous fatty acids and the fatty acid biosynthesis machinery

  • Engineering this pathway could improve utilization of non-standard fatty acid substrates

  • Applications include valorization of waste fatty acids and production of specialized lipid products

Bifunctional Enzyme Design Principles:

  • Structure-function studies of aas can inform the design of novel bifunctional enzymes

  • Domain organization analysis can guide the creation of chimeric enzymes with new combinations of activities

  • Understanding the coordination between the two catalytic activities provides insight for synthetic biology applications

Methodological Approach for Strain Development:

  • Rational protein engineering based on the three conserved domains identified in the aas protein

  • Directed evolution to enhance specific activities or alter substrate preferences

  • Integration with other metabolic engineering efforts targeting phospholipid and fatty acid metabolism

For effective utilization in metabolic engineering, careful consideration must be given to the rate-limiting nature of the aas enzyme in exogenous lipid incorporation pathways , suggesting that its expression levels and activity will be critical parameters for optimization.

What implications does aas protein function have for bacterial membrane biology?

The bifunctional aas protein plays a critical role in bacterial membrane biology with several important implications:

Membrane Phospholipid Remodeling:

  • The 2-acyl-GPE acyltransferase activity allows for direct reacylation of lysophospholipids, providing a mechanism for membrane repair and remodeling

  • This activity may be particularly important under conditions that cause membrane damage, such as environmental stress or antimicrobial exposure

  • The system represents a key pathway for maintaining membrane homeostasis

Exogenous Fatty Acid Utilization:

  • The acyl-ACP synthetase activity creates a direct pathway for incorporating environmental fatty acids into endogenous lipid metabolism

  • This capability allows bacteria to adapt their membrane composition in response to available fatty acid substrates

  • As the rate-limiting enzyme in this process , aas represents a key control point for environmental adaptation

Membrane Composition Regulation:

  • The dual activities of aas suggest a coordinated mechanism for maintaining optimal membrane phospholipid composition

  • The enzyme likely plays a role in responding to membrane fluidity changes

  • Understanding this regulation provides insight into bacterial adaptation mechanisms

Implications for Antimicrobial Resistance:

  • Membrane composition alterations via aas-mediated pathways may contribute to antimicrobial resistance mechanisms

  • The enzyme's role in membrane repair could help bacteria survive membrane-targeting antimicrobials

  • This suggests potential for developing inhibitors targeting aas function as novel antimicrobial adjuvants

These implications highlight the central importance of aas protein in bacterial membrane biology, particularly in contexts where membrane adaptation and repair are critical for survival. The enzyme represents a fascinating example of how bifunctional proteins can coordinate related metabolic activities within a single polypeptide.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.