Recombinant Escherichia coli O139:H28 Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Description

Genetic and Biochemical Characteristics

The cls gene (UniProt ID: A7ZL20) is located at minute 28.02 on the E. coli genetic map and encodes a 486-amino acid polypeptide (46–48 kDa) . Recombinant cls is typically expressed as a His-tagged fusion protein (N-terminal) in E. coli BL21(DE3) strains under T7 promoter control, achieving high yields (e.g., 1,200× wild-type activity) .

PropertyValue
Gene NameclsA, cls
UniProt IDA7ZL20
Protein LengthFull-length (1–486 aa)
Molecular Mass46 kDa (purified enzyme)
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
StorageLyophilized powder at -20°C/-80°C; avoid freeze-thaw cycles

Catalytic Activity

Cls catalyzes the reversible transfer of phosphatidyl groups between two PG molecules, producing CL (diphosphatidylglycerol) and glycerol . Key features include:

  • Substrate Specificity: PG is the primary substrate, with polyols (e.g., mannitol) enabling alternative phosphatidylglycerol analogs .

  • Inhibition: CL (product inhibition) and phosphatidate inhibit activity, while phosphatidylethanolamine partially offsets CL inhibition .

  • Mixed Micelle Assay: Activity is measured using phosphatidyl[2-³H]glycerol in a detergent-solubilized system .

Genetic Regulation

  • Expression Control: cls is influenced by terminal electron acceptors (e.g., oxygen > nitrate > fumarate) and growth phase .

  • Autoregulation: No evidence of autogenous regulation; cls expression remains unaffected by CL levels or null mutations .

Recombinant Expression and Purification

Recombinant cls is produced via:

  1. Cloning: The cls gene is inserted downstream of a T7 promoter in plasmids like pLR3 .

  2. Induction: Isopropyl β-D-1-thiogalactopyranoside (IPTG) induces overexpression in E. coli BL21(DE3) .

  3. Purification: Triton X-114 extraction and DEAE-cellulose chromatography yield homogeneous protein .

StepCondition
Expression HostE. coli BL21(DE3) (T7 RNA polymerase)
Yield>1,200× wild-type membrane activity
PurificationTriton X-114 phase separation → DEAE-cellulose chromatography

Conserved Regions

Comparative analysis of bacterial cls enzymes reveals three conserved motifs:

  1. RN(Q)HRK: A pentapeptide linked to catalytic activity .

  2. HXK: A potential active-site motif .

Posttranslational Modifications

Purified cls exhibits a 46 kDa mass, ~8 kDa smaller than the predicted 54 kDa, suggesting proteolytic processing or truncation during maturation .

Physiological Roles

  • Membrane Stability: cls mutants exhibit prolonged doubling times, reduced viability in stationary phase, and altered antibiotic sensitivity (e.g., novobiocin resistance) .

  • Stress Adaptation: CL synthesis is critical for maintaining membrane curvature and responding to osmotic stress .

Inhibition Studies

InhibitorEffect
CardiolipinCompetitive inhibition (reduces enzyme activity)
PhosphatidateStrong inhibition (non-competitive)
MgCl₂Enhances CL inhibition

Biotechnological Relevance

Recombinant cls is used to study:

  • Cardiolipin Biosynthesis: Mechanistic insights into PG → CL conversion.

  • Membrane Dynamics: Role of CL in bacterial physiology and pathogenesis .

Product Specs

Form
Lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on shipping method and destination. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
clsA; cls; EcE24377A_1397; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Escherichia coli O139:H28 (strain E24377A / ETEC)
Target Names
clsA
Target Protein Sequence
MTTVYTLVSWLAILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLAVGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAEENSSVAAPLFKLCERRQGIAGVKGNQ LQLMTESDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAAARRGIHCRLMLD SAGSVAFFRSPWPELMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMIMIDNYIAYTGSM NMVDPRYFKQDAGVGQWIDLMARMEGPIATAMGIIYSCDWEIETGKRILPPPPDVNIMPF EQASGHTIHTIASGPGFPEDLIHQALLTAAYSAREYLIMTTPYFVPSDDLLHAICTAAQR GVDVSIILPRKNDSMLVGWASRAFFTELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLAIDDKGFGADLAAVQDDYISRSRLLDARLWLKRPLWQRVAERLFY FFSPLL
Uniprot No.

Target Background

Function

Recombinant Escherichia coli O139:H28 Cardiolipin synthase (cls) catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, producing cardiolipin (CL) (diphosphatidylglycerol) and glycerol.

Database Links
Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is cardiolipin synthase and what is its function in bacterial cells?

Cardiolipin synthase (cls) is an essential enzyme responsible for synthesizing cardiolipin, a large anionic glycerol phospholipid composed of four acyl chains connected by a small glycerol head group. This conical-shaped phospholipid accumulates at membrane regions with negative curvature. In Enterobacteriaceae, cardiolipin is synthesized within the inner membrane primarily by the ClsA enzyme, with ClsB and ClsC providing supplementary synthesis capacity .

The main function of cardiolipin synthase is to catalyze the formation of cardiolipin through one of two mechanisms: either by condensing two phosphatidylglycerol (PG) molecules (as performed by ClsA and ClsB) or by condensing phosphatidylglycerol and phosphatidylethanolamine (PE) molecules (as performed by ClsC) . The specific E. coli O139:H28 CardioLipin Synthase is a full-length protein (486 amino acids) that has been characterized and produced as a recombinant protein for research applications .

How do different cardiolipin synthases in E. coli differ in their expression patterns and activity?

E. coli possesses three distinct cardiolipin synthases: ClsA, ClsB, and ClsC, each with unique expression patterns and activities:

  • ClsA (encoded by cls/clsA): Serves as the major cardiolipin synthase during exponential growth phase. Deletion of clsA results in almost complete loss of detectable cardiolipin (from approximately 7% in wild-type to undetectable levels) and a corresponding increase in phosphatidylglycerol .

  • ClsB (encoded by ybhO): Shows minimal contribution during exponential growth. Deletion of clsB has negligible effect on cardiolipin levels under standard growth conditions .

  • ClsC (encoded by ymdC): Becomes significantly active during stationary phase. Evidence shows that clsC contributes to cardiolipin synthesis during stationary phase, as a clsA mutant shows approximately 1% cardiolipin in stationary phase, but a clsA clsC double mutant completely lacks cardiolipin .

During intracellular growth conditions, expression levels of clsB and clsC can be induced approximately 10-fold, suggesting environmental regulation of cardiolipin synthesis .

What experimental approaches can quantify cardiolipin levels in bacterial membranes?

Researchers can employ several methodological approaches to quantify cardiolipin levels:

  • Bligh-Dyer Phospholipid Isolation: This liquid-liquid extraction method effectively separates phospholipids from bacterial membranes. The protocol uses chloroform, methanol, and water to create phase separation that isolates lipids from cellular components .

  • Thin-Layer Chromatography (TLC): Following extraction, phospholipids can be separated and visualized using TLC. This technique allows for relative quantification of different phospholipids, including cardiolipin, phosphatidylglycerol, and phosphatidylethanolamine .

  • Membrane Fractionation: To analyze the distribution of cardiolipin between inner and outer membranes, researchers can use Sarkosyl solubilization to fractionate the membranes before applying the extraction and separation techniques. Verification of proper membrane separation should be performed using Western blotting for membrane-specific marker proteins (e.g., SecA for inner membrane and OmpA for outer membrane) .

These methods typically show that cardiolipin constitutes approximately 7% of total phospholipids during exponential growth phase and increases to about 10% during stationary phase in wild-type E. coli .

What expression systems are optimal for producing recombinant E. coli O139:H28 cardiolipin synthase?

For optimal recombinant production of E. coli O139:H28 cardiolipin synthase:

  • Expression System: The most effective expression system is E. coli itself, which provides the appropriate cellular machinery for proper folding of this membrane-associated enzyme. Commercial recombinant Cardiolipin synthase proteins are produced using E. coli expression systems .

  • Tagging Strategy: N-terminal His-tagging has proven successful for purification purposes without compromising enzymatic function. The full-length protein (amino acids 1-486) with an N-terminal His-tag maintains its structural integrity and function .

  • Expression Conditions: While specific optimization parameters depend on the expression vector and strain used, general recommendations include:

    • Induction at mid-log phase (OD600 ~0.6-0.8)

    • Lower induction temperatures (16-25°C) to enhance proper folding

    • Extended expression periods (overnight) at reduced temperatures

    • Careful cell lysis methods to preserve membrane protein integrity

What purification strategies yield functional cardiolipin synthase protein?

To obtain functional recombinant cardiolipin synthase:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin effectively captures His-tagged cardiolipin synthase. Gentle detergents must be incorporated in all buffers to maintain protein solubility.

  • Buffer Composition: Recommended storage buffer includes Tris/PBS-based buffer at pH 8.0 with 6% trehalose as a stabilizing agent .

  • Storage Conditions: The purified protein should be stored as lyophilized powder or in solution with 5-50% glycerol (with 50% being optimal) at -20°C/-80°C. Repeated freeze-thaw cycles should be avoided to maintain enzyme activity .

  • Reconstitution Protocol: For experimental use, reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

Storage ParameterRecommendation
BufferTris/PBS-based, pH 8.0, with 6% Trehalose
Glycerol Content5-50% (50% optimal)
Storage Temperature-20°C/-80°C
Working SolutionStore at 4°C for up to one week
Reconstitution Concentration0.1-1.0 mg/mL

How does cardiolipin contribute to bacterial membrane organization and function?

Cardiolipin plays several critical roles in bacterial membrane organization:

  • Membrane Curvature: Due to its conical shape (four large acyl chains connected by a small glycerol head group), cardiolipin naturally accumulates at membrane regions with negative curvature. This property makes it essential for maintaining proper membrane architecture, particularly at bacterial poles .

  • Protein Localization: Cardiolipin facilitates the proper localization of various membrane proteins. In pathogens like Shigella flexneri, cardiolipin in the outer membrane is crucial for proper presentation of virulence proteins such as IcsA on the bacterial surface .

  • Electron Transport: Similar to its role in mitochondria, cardiolipin influences both the localization and activity of electron transport proteins in the bacterial inner membrane .

  • Membrane Domain Formation: Cardiolipin contributes to the formation of specialized membrane domains, particularly at the poles of bacterial cells, which affects numerous cellular processes including division and protein sorting .

What is the relationship between cardiolipin synthesis and bacterial cell division?

Cardiolipin synthesis is intimately connected to bacterial cell division through several mechanisms:

  • Division Site Localization: Cardiolipin localizes to the poles and division septa in bacterial cells, where it helps recruit and stabilize division proteins .

  • Filamentation in Deficient Strains: When cardiolipin synthesis is disrupted (e.g., in clsA mutants), bacteria can develop filamentous morphology during intracellular growth, indicating impaired cell division. This has been directly observed using time-lapse confocal microscopy of fluorescently labeled bacteria in host cells .

  • Intracellular Growth: Research using S. flexneri as a model shows that while clsA mutants initially grow normally inside host cells, they eventually form filaments after several rounds of replication, suggesting a progressive defect in the division process .

  • Protein Functionality: Cardiolipin affects the localization and activity of proteins required for cell division, creating a direct link between phospholipid composition and the division machinery .

The specific mechanisms connecting cardiolipin to division proteins involve both direct binding interactions and indirect effects through membrane curvature and fluidity.

How does cardiolipin transport to the outer membrane affect bacterial pathogenesis?

The transport of cardiolipin from the inner to the outer membrane significantly impacts bacterial pathogenesis through several mechanisms:

  • Protein Transport System: In Enterobacteriaceae, cardiolipin is transported from the inner to the outer membrane by PbgA (also known as YejM), a dedicated phospholipid transporter .

  • Virulence Protein Localization: Cardiolipin in the outer membrane facilitates proper presentation of virulence factors. In S. flexneri, cardiolipin is essential for proper localization of the actin polymerization protein IcsA on the bacterial surface, which is critical for cell-to-cell spread during infection .

  • Plaque Formation: Experimental evidence shows that both clsA (cardiolipin synthesis) and pbgA (cardiolipin transport) mutants have severe defects in plaque formation in cell culture models, indicating impaired cell-to-cell spread .

  • Differential Effects: Interestingly, while both mutants have defects in pathogenesis, they act at different points in the virulence pathway. The pbgA mutant fails to properly localize IcsA to the bacterial surface, preventing cell-to-cell spread, whereas the clsA mutant shows partial IcsA localization but later develops division defects .

These findings establish a dual function for cardiolipin in bacterial pathogenesis: in the inner membrane, it supports proper cell division during intracellular growth, while in the outer membrane, it enables the presentation of virulence factors required for pathogen dissemination .

What are the functional domains and structural features of cardiolipin synthase?

While the search results don't provide direct information on the specific functional domains of E. coli O139:H28 cardiolipin synthase, inference from related research suggests that this enzyme contains:

  • Transmembrane Domains: The N-terminal region contains multiple transmembrane helices that anchor the protein in the bacterial inner membrane. The presence of these domains is supported by the hydrophobic nature of portions of the amino acid sequence .

  • Catalytic Domain: The enzyme contains a catalytic domain responsible for the condensation reaction between phospholipid substrates. In ClsA, this domain catalyzes the reaction between two phosphatidylglycerol molecules to form cardiolipin .

  • Substrate Recognition Sites: The enzyme must contain binding pockets for its phospholipid substrates, with specificity that differentiates between phosphatidylglycerol and other phospholipids.

The structure of cardiolipin synthase enables its localization to the bacterial inner membrane, where it can access its phospholipid substrates and contribute to membrane phospholipid composition.

How can recombinant cardiolipin synthase be used in synthetic biology applications?

Recombinant cardiolipin synthase offers several applications in synthetic biology:

  • Membrane Engineering: By expressing recombinant cardiolipin synthase in bacterial strains, researchers can modify membrane composition to alter properties such as permeability, fluidity, and curvature. This approach enables the creation of bacteria with customized membrane characteristics for various applications .

  • Biocontainment Strategies: Engineered dependency on cardiolipin synthase activity could be used to develop biocontainment strategies for genetically modified organisms, as disruption of cardiolipin synthesis leads to growth defects .

  • Biosensors Development: The localization properties of cardiolipin can be exploited to develop biosensors for detecting changes in membrane organization or bacterial cellular state.

  • Metabolic Engineering Platforms: Modification of membrane composition through cardiolipin synthase expression can create more robust bacterial strains for the production of biofuels, chemicals, or pharmaceuticals by enhancing tolerance to toxic products or process conditions.

What experimental approaches can distinguish the functions of different cardiolipin synthases in vivo?

To distinguish the functions of different cardiolipin synthases in vivo:

  • Gene Deletion Analysis: Constructing single, double, and triple deletion mutants of clsA, clsB, and clsC allows researchers to determine the contribution of each enzyme to total cardiolipin synthesis under different growth conditions. Analysis showed that clsA is the major contributor during exponential growth, while clsC contributes during stationary phase .

  • Growth Phase-Specific Analysis: By examining phospholipid composition at different growth phases (exponential vs. stationary), researchers can identify temporal patterns in cardiolipin synthase activity. This approach revealed that ClsC becomes active specifically during stationary phase .

  • Environmental Response Studies: Examining gene expression and cardiolipin levels under various environmental conditions (pH, osmolarity, temperature) can reveal condition-specific roles for each cardiolipin synthase.

  • Intracellular Infection Models: Using bacterial pathogens in cellular infection models allows the examination of cardiolipin synthase expression and function during host-pathogen interactions. Studies with S. flexneri revealed 10-fold induction of clsB and clsC during intracellular growth .

  • Fluorescent Tagging: Employing fluorescently tagged cardiolipin-binding probes in combination with confocal microscopy enables visualization of cardiolipin distribution in bacterial membranes and can reveal functional differences between synthases.

What are the current challenges in studying cardiolipin synthase function?

Several significant challenges persist in studying cardiolipin synthase function:

  • Functional Redundancy: The presence of multiple cardiolipin synthases (ClsA, ClsB, ClsC) with partially overlapping functions complicates the analysis of individual enzyme contributions .

  • Compensation by Other Phospholipids: When cardiolipin synthesis is impaired, other anionic phospholipids like phosphatidylglycerol can partially compensate for its absence, making it difficult to isolate specific cardiolipin-dependent phenotypes. For instance, in clsA mutants, increased phosphatidylglycerol in the outer membrane partially compensates for the loss of cardiolipin .

  • Membrane Protein Challenges: As an integral membrane protein, cardiolipin synthase presents technical challenges for structural studies, purification, and reconstitution in active form.

  • Environmental Variability: The activity and expression of cardiolipin synthases vary significantly based on growth conditions, growth phase, and environmental stressors, requiring controlled experimental conditions for consistent results .

  • Integration with Other Membrane Components: Cardiolipin functions as part of a complex membrane environment, making it difficult to distinguish direct effects of cardiolipin from indirect effects through interactions with other membrane components.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.