Recombinant Escherichia coli O139:H28 Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli O139:H28 Cobalamin Synthase (cobS)

Cobalamin synthase (cobS) is a key enzyme in the biosynthesis of cobalamin (vitamin B₁₂), functioning as a cobalamin synthetase that catalyzes the final steps of the pathway. In E. coli O139:H28, a pathogenic enterotoxigenic E. coli (ETEC) strain, recombinant cobS has been engineered for research and industrial applications. This strain is notable for producing heat-stable and heat-labile enterotoxins, as well as colonization factors like CS1 and CS3 . The recombinant cobS protein is produced via heterologous expression in E. coli, often with engineered tags for purification and stability.

Biochemical Properties and Functional Role

Table 1: Key Biochemical Properties of Recombinant E. coli O139:H28 cobS

PropertyDescriptionSource
Gene LocusEcE24377A_2274 (strain E24377A)
Protein Length247 amino acids
Molecular Weight~27.3 kDa (estimated from sequence)
TagsN-terminal His-tag (for purification)
Enzymatic ActivityCatalyzes adenosylcobinamide-phosphate (AdoCbi-P) to adenosylcobalamin (AdoCbl)
Substrate RequirementsCobalt, ATP, and dimethylbenzimidazole (DMB)
Optimal ConditionspH 7.5–8.5, 25–37°C (based on E. coli cobS homologs)

CobS operates in the salvage pathway of cobalamin biosynthesis, converting AdoCbi-P to AdoCbl via ATP-dependent adenosylation . In E. coli, this pathway is induced by cobinamide, a precursor metabolite . The enzyme interacts with cobC (a phosphatase) and pspA (a phage shock protein) to maintain membrane stability during overexpression .

Recombinant Production and Challenges

  • Protein Toxicity: Overexpression disrupts the proton motive force (PMF), leading to membrane instability and cell death .

  • Cobalt Dependency: Cobalt uptake is essential for enzyme activity, necessitating engineered transporters (e.g., CbiM,N,Q,O) .

  • Multienzyme Complex Formation: CobS associates with cobC and other proteins to form active complexes, requiring co-expression for optimal function .

Mitigation Strategies:

  1. Co-expression of cobC and pspA: Alleviates PMF dissipation and stabilizes membrane integrity .

  2. Use of Specialized Strains: Strains like C41(DE3) or C43(DE3) tolerate toxic protein expression better than BL21(DE3) .

  3. Tag Optimization: N-terminal His-tags enhance solubility and purification efficiency .

Research Applications and Insights

Table 2: Key Research Findings on cobS

Study FocusFindingsSource
Enzymatic MechanismCobS binds HBAD (hydrogenobyrinic acid a,c-diamide) and chelates cobalt
Membrane InteractionCobS interacts with liposomes via cobC, forming a functional complex
Evolutionary OriginE. coli cob operon likely acquired via horizontal gene transfer
Toxicity in OverexpressioncobS overexpression causes EtBr accumulation, indicating PMF collapse

CobS has been studied for its role in:

  • Vitamin B₁₂ Biosynthesis: In engineered E. coli, cobS enables de novo cobalamin production when combined with other pathway genes .

  • Pathogenicity: While O139:H28 produces toxins, cobS itself is not directly linked to virulence but is critical for metabolic adaptation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
cobS; EcE24377A_2274; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Escherichia coli O139:H28 (strain E24377A / ETEC)
Target Names
cobS
Target Protein Sequence
MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG VPLAALFSVLVLALMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGEPILASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGEL VFLLALL
Uniprot No.

Target Background

Function
Cobalamin synthase (cobS) catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by combining adenosylcobinamide-GDP and alpha-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cobalamin synthase (CobS) and what is its specific role in the vitamin B12 biosynthetic pathway?

Cobalamin synthase (CobS) is an enzyme that catalyzes a key step in the assembly of the nucleotide loop of adenosylcobalamin (vitamin B12). Specifically, CobS functions as the cobalamin-5′-phosphate synthase in the nucleotide loop assembly pathway, joining adenosylcobinamide-GDP (AdoCbi-GDP) with α-ribazole-5′-phosphate to form adenosylcobalamin-5′-phosphate (AdoCbl-5′-P) .

In the vitamin B12 biosynthetic pathway, CobS works in concert with three other enzymes—CobU, CobT, and CobC—to complete the final stages of cobalamin assembly. In Salmonella typhimurium, these four proteins together catalyze the late steps that define the nucleotide loop assembly pathway . CobS accepts the products of the CobU reaction (AdoCbi-GDP) and the CobT reaction (α-ribazole-5′-P) as substrates, demonstrating its position in the sequential pathway of cobalamin synthesis .

How can researchers confirm the cobalamin synthase activity of recombinant CobS?

Confirming cobalamin synthase activity of recombinant CobS can be accomplished through multiple complementary approaches:

  • Growth complementation assays: Incubation of AdoCbi-GDP and α-ribazole-5′-P with cell-free extract containing recombinant CobS yields a cobamide that can support cobalamin-dependent growth of auxotrophic strains like JE212. No growth is observed when the same substrates are incubated with control extracts lacking CobS .

  • In vitro enzymatic assays: Purified (His)6-tagged CobS can be used in reactions with the appropriate substrates, with specific activity measured at approximately 8 nmol of product per minute per mg of protein .

  • Radiolabeled substrate tracking: Quantification of cobalamin synthase activity can be achieved using radiolabeled substrates in the reaction mixture, allowing precise measurement of product formation .

  • HPLC isolation and characterization: The products of CobS reactions can be isolated by reverse-phase HPLC after derivatization with KCN. The resulting cyanocobalamin derivatives can be identified by their distinctive retention times and UV-visible spectra .

What substrate requirements are necessary for optimal CobS activity?

For optimal CobS activity, the following substrates and conditions are essential:

  • Direct substrates: AdoCbi-GDP (the product of the CobU reaction) and α-ribazole-5′-phosphate (the product of the CobT reaction) are the primary substrates for CobS .

  • Complete pathway substrates: In a complete nucleotide loop assembly system, adenosylcobinamide (AdoCbi), GTP, 5,6-dimethylbenzimidazole (DMB), and nicotinate mononucleotide (NaMN) serve as the initial precursors that are converted by CobU and CobT into the substrates for CobS .

  • Cofactor requirements: While not explicitly detailed in the search results, cobalamin synthases typically require metal cofactors for optimal activity, with cobalt being particularly important in the cobalamin biosynthetic pathway .

  • Physiological conditions: The enzymatic activity of CobS is likely optimal under conditions that mimic the bacterial cytoplasm, including appropriate pH, ionic strength, and redox environment.

How does CobS interact with other enzymes in the complete vitamin B12 biosynthetic pathway?

CobS functions within a complex network of enzymatic interactions in the vitamin B12 biosynthetic pathway:

  • Sequential pathway integration: CobS accepts the products of the CobU reaction (AdoCbi-GDP) and the CobT reaction (α-ribazole-5′-P), demonstrating its dependent position in the biosynthetic sequence . This sequential arrangement highlights the importance of proper expression and activity of upstream enzymes for effective CobS function.

  • Coordinated function with CobC: The product of the CobS reaction, AdoCbl-5′-P, serves as the substrate for CobC, which dephosphorylates it to form adenosylcobalamin (AdoCbl) . This coordination between CobS and CobC determines the timing of phosphate removal and final product formation.

  • Module-based engineering approach: In metabolic engineering of E. coli for vitamin B12 production, CobS is typically incorporated into a module alongside CobU, CobT, and CobC (Module 5) to convert AdoCbi-P to AdoCbl . This modular approach enables systematic optimization of the pathway.

  • Cross-species enzyme compatibility: Research has demonstrated that CobS proteins from various bacterial species (S. meliloti, B. melitensis, R. capsulatus) can be expressed and function in E. coli, although with varying efficiencies . This interspecies compatibility is crucial for heterologous pathway construction.

What are the key challenges in engineering E. coli for de novo biosynthesis of vitamin B12 using CobS?

Engineering E. coli for de novo vitamin B12 biosynthesis faces several significant challenges:

  • Cobalt chelation bottleneck: The availability and proper incorporation of cobalt is a major limiting factor in cobalamin biosynthesis. Metabolic engineering efforts must address cobalt chelation issues to improve vitamin B12 production .

  • Module 4 bottlenecks: The conversion of CBAD to AdoCbi-P (Module 4 in engineered systems) represents another significant limitation in the pathway that must be overcome through targeted engineering approaches .

  • Expression optimization: Achieving balanced expression of all necessary enzymes, including CobS, requires careful optimization of gene expression levels, often necessitating the use of different plasmids or genomic integration strategies .

  • Precursor supply: Ensuring adequate supply of precursors like Uro III may require additional engineering of upstream pathways, such as the incorporation of HemO, HemB, HemC, and HemD (Module 6) to boost precursor availability .

  • Fermentation condition optimization: Even with optimized genetic constructs, fermentation conditions must be carefully tuned to maximize vitamin B12 production, as demonstrated by the significant improvement in yields (up to 307.00 μg g−1 DCW) achieved through such optimization .

How do heterologous CobS proteins from different bacterial species compare in functionality when expressed in E. coli?

Heterologous CobS proteins from different bacterial species exhibit varying functionality when expressed in E. coli:

  • In vitro vs. in vivo activity discrepancies: CobS proteins from S. meliloti, B. melitensis, and R. capsulatus can be purified and shown to be active in vitro, but may not show detectable activity when expressed in vivo in E. coli . This highlights the complexity of establishing functional heterologous pathways.

  • Purification and activity confirmation: CobS proteins from various species can be successfully purified using affinity chromatography (with C-terminal hexa-histidine tags) and their activity confirmed through in vitro assays with appropriate substrates and detection by LC-MS .

  • Cobalt metabolism effects: The discrepancies between in vitro and in vivo results suggest that factors related to cobalt metabolism in E. coli may significantly affect the functionality of heterologous CobS proteins .

  • Expression optimization requirements: Successful expression of functional heterologous CobS often requires optimization strategies such as fusion tags (e.g., N-terminal hexa-his tags) to increase translation efficiency .

What analytical methods are most effective for detecting and quantifying the products of CobS-catalyzed reactions?

Several analytical methods have proven effective for detecting and quantifying CobS reaction products:

  • Reverse-phase HPLC with UV-visible detection: After derivatization with KCN, corrinoids produced by CobS can be isolated by RP-HPLC. The reaction product (CNCbl-5′-P) elutes at approximately 33.5 minutes, distinct from authentic CNCbl which elutes at 36.9 minutes .

  • UV-visible spectroscopy: The UV-visible spectrum of CobS reaction products provides valuable identification information. Despite different retention times, CNCbl-5′-P shows a UV-visible spectrum identical to that of authentic CNCbl .

  • Mass spectrometry: Mass spectrometry provides definitive identification of CobS reaction products, confirming molecular weights and structural features of the synthesized cobamides .

  • Biological activity assays: The biological activity of CobS-produced cobamides can be verified through growth assays using cobalamin auxotrophic strains, providing functional confirmation of the synthesized molecules .

  • LC-MS analysis: Liquid chromatography-mass spectrometry is particularly valuable for confirming the activity of CobS and related enzymes, especially when detecting intermediate products in complex reaction mixtures .

What are the optimal conditions for expressing and purifying recombinant CobS from E. coli?

Optimal conditions for expressing and purifying recombinant CobS from E. coli include:

  • Expression systems: Effective expression can be achieved using T7 promoter-based systems, as demonstrated by the use of pT7-7 as a cloning vector for CobS expression .

  • Affinity tags: C-terminal or N-terminal hexa-histidine tags facilitate purification via affinity chromatography and can enhance translation efficiency . SDS-PAGE analysis can confirm successful purification of the tagged protein.

  • Expression enhancement strategies: For challenging proteins, fusion partners or expression optimization techniques may be necessary:

    StrategyPotential Benefit
    N-terminal fusion tagsIncreased translation efficiency
    Codon optimizationImproved expression in E. coli
    Low-temperature inductionEnhanced protein folding and solubility
    Co-expression with chaperonesImproved folding and solubility
  • Purification protocol: A typical purification protocol involves cell lysis, clarification of the lysate, affinity chromatography using Ni-NTA or similar resins, and elution with imidazole-containing buffers. Additional purification steps may include ion exchange or size exclusion chromatography .

  • Activity preservation: Including appropriate stabilizing agents and maintaining cold temperatures throughout purification helps preserve enzyme activity.

How can researchers design in vitro and in vivo systems to study CobS function?

Researchers can design effective systems to study CobS function through several approaches:

  • In vitro nucleotide loop assembly system: A complete in vitro system can be established using purified CobU, CobS, and CobT proteins along with the precursors adenosylcobinamide, GTP, 5,6-dimethylbenzimidazole, and nicotinate mononucleotide. This allows for the synthesis and isolation of adenosylcobalamin-5′-phosphate under controlled conditions .

  • Simplified in vitro CobS reaction: Researchers can directly study CobS activity by providing purified AdoCbi-GDP and α-ribazole-5′-P as substrates and analyzing the formation of adenosylcobalamin-5′-phosphate .

  • Cell-free extract assays: Cell-free extracts from strains expressing CobS can be used to assess enzyme activity in a more native-like environment while avoiding whole-cell complications .

  • In vivo plasmid-based expression systems: For studying CobS in vivo, plasmid-based expression systems (such as pCOBS4) can be constructed. The activity of the expressed enzyme can be verified by feeding appropriate substrates and measuring cobalamin-dependent growth of auxotrophic strains .

  • Modular pathway engineering: A systematic approach to studying CobS in the context of the complete pathway involves dividing the vitamin B12 biosynthetic pathway into functional modules expressed on individual plasmids or integrated into the E. coli genome. For example, Module 5 containing CobU, CobS, CobT, and CobC can convert AdoCbi-P to AdoCbl .

What strategies can improve the solubility and activity of recombinant CobS in E. coli?

Several strategies can improve the solubility and activity of recombinant CobS in E. coli:

  • N-terminal sequence modification: Modifying the N-terminal sequences of recombinant proteins can significantly increase their production yield in E. coli. This approach uses directed evolution-based methodology to screen large numbers of diversified sequences coding for the N-termini of the target protein .

  • FACS-based selection methodology: Using a GFP gene cloned at the C-terminus of the expressed cobS gene allows for fluorescence-activated cell sorting (FACS) to identify variants with increased expression levels. This systematic workflow has been shown to elevate the yield of soluble recombinant proteins up to over 30-fold .

  • Codon optimization: Optimizing codons for expression in E. coli can improve translation efficiency and protein yield. This strategy is particularly relevant when expressing cobS genes from organisms with different codon usage patterns .

  • Fusion partners: Fusion partners such as thioredoxin A (TrxA) or glutathione S-transferase (GST) can significantly enhance the solubility of recombinant proteins in E. coli .

  • Addressing cobalt metabolism: Since cobalt is essential for cobalamin biosynthesis, incorporating cobalt transport proteins (such as CbiM,N,Q,O) can enhance the functionality of recombinant CobS by ensuring adequate cobalt uptake from the environment .

How can metabolic engineering approaches be used to optimize CobS function in complete vitamin B12 biosynthetic pathways?

Metabolic engineering approaches to optimize CobS function within complete vitamin B12 biosynthetic pathways include:

Through careful optimization of these parameters, vitamin B12 production in engineered E. coli has been improved to 307.00 μg g−1 DCW , demonstrating the potential of comprehensive metabolic engineering approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.