Recombinant Escherichia coli O139:H28 Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Overview of RnfE

RnfE is a component of the Rnf complex, a membrane-bound electron transport chain that couples ferredoxin oxidation to NAD+/NADH interconversion, generating a sodium ion gradient across the membrane . In E. coli O139:H28, the recombinant RnfE protein is produced via heterologous expression in E. coli and purified with a His-tag for stability and solubility .

SpecificationDetails
AccessionA7ZM92
Length231 amino acids (full-length)
Expression HostE. coli
TagN-terminal His-tag
Molecular WeightNot explicitly stated; estimated based on sequence length (~26 kDa)
Storage BufferTris-based buffer + 50% glycerol
Stability-20°C or -80°C (avoid repeated freeze-thaw cycles)

Functional Role in E. coli

The Rnf complex, including RnfE, is essential for anaerobic respiration and energy conservation. In E. coli O139:H28, it likely supports survival in environments with limited oxygen by coupling electron transport to Na+ extrusion .

Biochemical Properties

  • Electron Transfer Pathway:

    • Oxidizes ferredoxin (low redox potential) to reduce NAD+ (higher redox potential) .

    • Generates a Na+ gradient, which drives ATP synthesis via Na+-ATP synthases .

  • Subunit Interactions:

    • RnfE interacts with RnfB and RnfC to form a stable complex; absence of one subunit destabilizes others .

Research Applications

The recombinant RnfE protein is used in structural studies, enzymatic assays, and biotechnological applications.

Experimental Uses

  1. Enzymatic Reconstitution:

    • RnfE-containing complexes are reconstituted into lipid vesicles to study Na+ translocation and electron transfer kinetics .

  2. Proteomics:

    • Identified in 2DE gels and MALDI-TOF/MS analyses of E. coli proteomes, highlighting its role in stress responses and bioenergetics .

  3. Antibody Production:

    • Recombinant RnfE is used to generate polyclonal antibodies for immunoprecipitation and Western blotting .

Comparative Analysis with Other Rnf Proteins

The Rnf complex exhibits conserved structural and functional features across bacterial species, though variations exist in subunit composition and ion specificity.

FeatureRnfE (E. coli O139:H28)Rnf Complex (A. woodii)
Ion SpecificityNa+ translocationNa+ translocation
Subunit TopologyN-out-C-out (RnfE)N-out-C-out (RnfC, RnfB, etc.)
Electron DonorFerredoxin (inferred)Ferredoxin
Electron AcceptorNAD+NAD+

Challenges and Future Directions

  • Structural Elucidation: High-resolution crystallography of the Rnf complex remains challenging due to its membrane-bound nature .

  • Biotechnological Potential: Engineering RnfE for enhanced electron transfer efficiency could improve biofuel production or bioremediation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer requirements.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rsxE; rnfE; EcE24377A_1841; Ion-translocating oxidoreductase complex subunit E; Rsx electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Escherichia coli O139:H28 (strain E24377A / ETEC)
Target Names
rsxE
Target Protein Sequence
MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAGKYLIDERMKKRRTEAAAERALPNGETGNV
Uniprot No.

Target Background

Function
This protein is a component of a membrane-bound complex that couples electron transfer with ion translocation across the membrane. It plays a critical role in maintaining the reduced state of SoxR.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Rnf complex and what role does RnfE play in its function?

The Rnf complex represents a primary respiratory enzyme in numerous anaerobic prokaryotes, including specific strains of E. coli. This complex functions by transferring electrons from ferredoxin to NAD+ while simultaneously pumping ions (either Na+ or H+) across cellular membranes, which ultimately powers ATP synthesis. The RnfE protein serves as a critical component within this electron transport chain complex . The Rnf complex is particularly significant as it constitutes an evolutionary predecessor to the Na+-pumping NADH-quinone oxidoreductase (Nqr). In its reverse operational mode, the Rnf complex utilizes electrochemical ion gradients to facilitate ferredoxin reduction with NADH, generating low-potential electrons essential for nitrogenases and CO2 reductases . This bidirectional capability highlights the complex's versatility and importance in cellular energetics.

How does the molecular structure of RnfE contribute to electron transport mechanisms?

The RnfE protein contains specific structural domains that facilitate electron transfer within the larger Rnf complex. Recent structural studies using redox-controlled cryo-electron microscopy have revealed that the Rnf complex contains a unique membrane-embedded [2Fe2S] cluster that plays a crucial role in the redox-driven Na+ pumping mechanism . The reduction of this iron-sulfur cluster electrostatically attracts Na+ ions and triggers an inward/outward transition with alternating membrane access. This conformational change drives both the Na+ pump and the reduction of NAD+ . The structural features of RnfE are evolutionarily conserved, reflecting their fundamental importance in energy conversion systems within anaerobic bacteria that operate at the thermodynamic limits of life.

What are the optimal expression systems for recombinant production of E. coli O139:H28 RnfE protein?

For recombinant expression of E. coli O139:H28 RnfE protein, researchers typically employ controlled expression systems that maintain the native conformation of membrane-associated proteins. The optimal expression system should account for the hydrophobic nature of membrane proteins and the need for proper folding and insertion into membranes. Expression in E. coli BL21(DE3) using vectors with inducible promoters like pET or pBAD systems has shown promising results for Rnf complex proteins . When expressing RnfE, it is essential to optimize induction conditions (temperature, inducer concentration, and duration) to prevent the formation of inclusion bodies. Co-expression with chaperone proteins may enhance proper folding. For functional studies, expression in anaerobic conditions might better reflect the native environment where this protein typically functions.

How can researchers verify the functional integrity of recombinant RnfE protein?

Verifying the functional integrity of recombinant RnfE requires a multi-faceted approach:

  • Biochemical activity assays: Measure electron transfer rates using artificial electron donors and acceptors to validate the redox activity.

  • Ion transport assays: Assess Na+ or H+ translocation across membrane vesicles containing the reconstituted RnfE or complete Rnf complex.

  • Structural verification: Employ circular dichroism spectroscopy to confirm proper secondary structure formation.

  • Iron-sulfur cluster incorporation: Use UV-visible spectroscopy to verify the presence of the characteristic [2Fe2S] cluster absorption peaks.

  • Membrane integration: Confirm proper membrane insertion using protease protection assays or membrane fractionation techniques.

The combination of these approaches provides comprehensive validation of both structural integrity and functional activity .

How does the genomic context of rnfE in E. coli O139:H28 compare with other pathogenic and non-pathogenic E. coli strains?

The genomic context of rnfE in E. coli O139:H28 exhibits notable differences when compared with other E. coli strains. Comparative genomic analyses reveal that hybrid E. coli pathotypes, which may include the O139:H28 serotype, often demonstrate unique genomic organizations that reflect their evolutionary history and virulence potential .

Genome-wide phylogenetic studies indicate that certain hybrid strains exhibit close relatedness with Enterotoxigenic E. coli (ETEC), STEC/ETEC hybrids, and commensal E. coli strains, suggesting potential acquisition of virulence factors through horizontal gene transfer . This genomic plasticity extends to energy metabolism genes including those encoding electron transport complexes.

The rnfE gene in pathogenic strains may be found in the context of pathogenicity islands or other mobile genetic elements, whereas in non-pathogenic strains, it is typically located within conserved regions associated with core metabolic functions. This distinction suggests that the genomic environment of rnfE may influence its regulation and potentially its functional characteristics across different E. coli lineages.

What is the relationship between RnfE function and virulence in pathogenic E. coli strains?

The relationship between RnfE function and virulence in pathogenic E. coli strains represents a complex interplay between metabolism and pathogenicity. Research suggests that energy metabolism proteins, including electron transport complexes like RnfE, may indirectly contribute to virulence through several mechanisms:

  • Metabolic adaptation: RnfE-containing complexes enable anaerobic respiration and energy generation in oxygen-limited environments encountered during infection.

  • Gene regulation networks: Studies on enterotoxigenic E. coli demonstrate that pathogen-host interactions trigger coordinated responses involving both virulence factors and metabolic pathways . Following host cell contact, genes for motility, adhesion, toxin production, and key regulatory molecules are substantially modulated, which may include changes in electron transport components.

  • Survival under stress: The Rnf complex's ability to function under varying electrochemical conditions may enhance bacterial persistence during host immune responses.

  • Host interaction effects: When ETEC interacts with intestinal epithelial cells, significant changes occur in the expression of genes governing energy metabolism, potentially including the rnf operon components .

This relationship underscores the integrated nature of bacterial metabolism and virulence, suggesting that metabolic proteins like RnfE might represent potential therapeutic targets beyond classical virulence factors.

What are the most effective methods for studying protein-protein interactions within the Rnf complex?

Investigating protein-protein interactions within the Rnf complex requires specialized approaches suitable for membrane protein complexes. The following methodologies have proven particularly effective:

MethodApplicationAdvantagesLimitations
Crosslinking coupled with mass spectrometryIdentifying interaction domainsCaptures transient interactionsMay introduce artifacts
Förster Resonance Energy Transfer (FRET)Real-time interaction dynamicsAllows live-cell measurementsRequires fluorescent labeling
Co-immunoprecipitationVerification of protein associationsPreserves native complexesMay miss weak interactions
Bacterial two-hybrid systemsScreening for interacting partnersHigh-throughput capabilityMay produce false positives
Cryo-electron microscopyStructural characterizationPreserves native structureTechnically challenging

Recent advances using redox-controlled cryo-electron microscopy have provided particularly valuable insights into the functional states along the electron transfer pathway in Na+-pumping Rnf complexes . When combined with biochemical functional assays and atomistic molecular simulations, these approaches have revealed the molecular mechanisms underlying redox-driven Na+ pumping. The reduction of the membrane-embedded [2Fe2S] cluster electrostatically attracts Na+ ions and triggers conformational changes that drive ion pumping .

What transcriptomic approaches can reveal the regulation of rnfE expression during host-pathogen interactions?

Transcriptomic analyses offer powerful insights into how rnfE expression is regulated during host-pathogen interactions. Several methodological approaches have proven particularly informative:

  • RNA-Seq analysis: Comparing transcriptomes of E. coli before and after exposure to host cells can reveal differential expression of rnfE and related genes. Pan-genome microarrays have been successfully employed to study changes in ETEC transcriptomes during host cell interactions .

  • Quantitative RT-PCR validation: Targeted qRT-PCR provides precise quantification of rnfE expression changes. This approach has been used to confirm expression patterns identified through broader transcriptomic screens in pathogenic E. coli .

  • Transcriptional reporter fusions: Constructing fusions between the rnfE promoter and reporter genes (like gfp or lacZ) enables real-time monitoring of gene expression. These reporter systems have successfully tracked expression changes in ETEC following host cell contact .

  • ChIP-seq analysis: This technique identifies transcription factors binding to the rnfE promoter region, elucidating regulatory mechanisms controlling expression.

  • Single-cell RNA-Seq: This emerging approach captures expression heterogeneity within bacterial populations during infection.

Studies on ETEC have demonstrated that following host cell contact, numerous genes involved in metabolic pathways undergo significant modulation, often coordinated with changes in virulence factor expression . These methodologies can reveal how rnfE regulation is integrated into broader pathogenic responses.

How can researchers address discrepancies in experimental results regarding the ion specificity (Na+ vs. H+) of the RnfE-containing complex?

Addressing discrepancies regarding ion specificity of RnfE-containing complexes requires systematic experimental approaches:

  • Controlled comparative studies: Direct comparisons between E. coli O139:H28 and other strains known to use either Na+ or H+ should be conducted under identical experimental conditions to eliminate methodological variations.

  • Mutagenesis of key residues: Site-directed mutagenesis targeting putative ion-binding sites can help identify critical amino acids determining ion selectivity. The reduction of the membrane-embedded [2Fe2S] cluster electrostatically attracts Na+, making this region a primary target for mutagenesis studies .

  • Isotope labeling experiments: Using isotopically labeled ions (e.g., 22Na+ or deuterium for H+) can provide direct evidence of which ions are transported by the complex.

  • Membrane vesicle transport assays: Inside-out vesicles allow precise measurement of ion transport rates using ion-specific fluorescent probes or electrodes.

  • Structural biology approaches: High-resolution structures obtained through cryo-EM or X-ray crystallography can reveal ion binding pockets and channel architectures .

  • Computational modeling: Molecular dynamics simulations can predict ion pathways and selectivity mechanisms when combined with experimental data.

Discrepancies may actually reflect genuine physiological adaptability, as some Rnf complexes might transport different ions depending on environmental conditions or evolutionary adaptations to specific ecological niches.

What strategies can overcome the challenges in crystallizing membrane-bound RnfE for structural studies?

Membrane protein crystallization presents significant challenges due to the hydrophobic nature of these proteins. For RnfE, researchers can employ the following strategies:

  • Detergent screening: Systematic testing of various detergents for solubilization while maintaining native structure. This typically begins with mild detergents (DDM, LMNG) and progresses to more aggressive ones if needed.

  • Lipidic cubic phase crystallization: This technique maintains a membrane-like environment during crystallization, which can preserve RnfE structure.

  • Antibody-mediated crystallization: Using antibody fragments (Fab or nanobodies) that bind to hydrophilic regions of RnfE can increase the polar surface area available for crystal contacts.

  • Fusion protein approaches: Creating chimeric proteins by fusing stable, crystallizable proteins to RnfE can enhance solubility and crystallization propensity.

  • Truncation and domain approaches: Identifying stable domains within RnfE that maintain function while improving crystallization properties.

  • Alternative structural methods: When crystallization proves particularly challenging, cryo-electron microscopy has emerged as a powerful alternative for membrane protein structural determination. This approach has successfully revealed key functional states of the Rnf complex from Acetobacterium woodii .

  • Nanodiscs and amphipols: These systems provide a more native-like environment than detergent micelles and can stabilize RnfE in a functional conformation.

Each approach requires careful optimization, and often a combination of strategies yields the best results.

How might CRISPR-Cas9 genome editing be utilized to investigate RnfE function in pathogenic E. coli strains?

CRISPR-Cas9 genome editing offers revolutionary possibilities for investigating RnfE function in pathogenic E. coli strains:

  • Precise gene knockout studies: CRISPR-Cas9 allows creation of clean rnfE deletions without disrupting surrounding genes or leaving selection markers, enabling precise phenotypic characterization.

  • Domain-specific mutagenesis: Rather than deleting the entire gene, CRISPR can introduce specific mutations in functional domains, such as the [2Fe2S] cluster binding region or ion channel residues .

  • Promoter modulation: Targeted modifications to the rnfE promoter region can help elucidate regulatory mechanisms controlling expression during infection.

  • Tagged protein expression: Inserting epitope tags or fluorescent protein fusions at the genomic locus ensures native expression levels for localization and interaction studies.

  • Comparative strain analysis: Identical mutations can be introduced across multiple E. coli strains (including O139:H28) to assess strain-specific phenotypic differences.

  • Conditional expression systems: Incorporating inducible systems at the native locus allows temporal control of RnfE expression during infection studies.

  • Base editing applications: Newer CRISPR variants permit single nucleotide changes without double-strand breaks, enabling subtle modifications to study structure-function relationships.

This precise genetic manipulation capability, combined with pathogen-host interaction models, can reveal how RnfE contributes to metabolic adaptation during infection and potentially identify new therapeutic targets.

What are the implications of Rnf complex research for developing novel antimicrobial strategies?

Research on the Rnf complex, including RnfE, has significant implications for developing innovative antimicrobial strategies:

  • Metabolic vulnerability targeting: The Rnf complex represents a potential metabolic chokepoint in anaerobic pathogens that rely on this system for energy conservation. Inhibitors specifically targeting RnfE or other complex components could disrupt cellular energetics in organisms that depend on this pathway .

  • Structural-based drug design: The detailed molecular understanding of redox-coupled sodium pumping mechanisms, including the role of the membrane-embedded [2Fe2S] cluster, provides specific targets for rational drug design .

  • Pathogen-specific approaches: The differences in Rnf complex composition and regulation between pathogens and commensals could allow development of narrow-spectrum antimicrobials with reduced impacts on beneficial microbiota.

  • Anti-virulence strategies: Since metabolic systems like the Rnf complex may indirectly support virulence through energy provision during infection, targeting these systems could reduce pathogenicity without directly selecting for resistance.

  • Biofilm disruption: The Rnf complex may play roles in biofilm formation or maintenance through energy provision, making it a potential target for anti-biofilm strategies.

  • Hybrid pathotype considerations: The emergence of hybrid E. coli pathotypes, potentially including O139:H28 strains, presents unique challenges and opportunities. Understanding the role of RnfE in these contexts could reveal vulnerabilities specific to emerging threats .

These approaches represent a departure from traditional antimicrobial targets and could help address the growing challenge of antibiotic resistance by exploiting fundamental energetic processes in pathogens.

How does research on RnfE contribute to our broader understanding of bacterial energy metabolism and pathogenesis?

Research on the RnfE protein and the broader Rnf complex significantly advances our understanding of bacterial energy metabolism and pathogenesis in several key dimensions:

  • Evolutionary insights: The Rnf complex represents an ancient mechanism for energy conservation, serving as an evolutionary predecessor to the Na+-pumping NADH-quinone oxidoreductase (Nqr) . Studying RnfE provides a window into the evolution of bioenergetic systems and adaptation to anaerobic environments.

  • Metabolic flexibility: The bidirectional functionality of the Rnf complex, capable of both generating ion gradients and utilizing them to drive difficult reductions, illustrates sophisticated energy management strategies in bacteria operating at thermodynamic limits .

  • Host-pathogen dynamics: Studies of transcriptional modulation during pathogen-host interactions reveal that energy metabolism genes, potentially including rnfE, are coordinated with virulence factor expression . This integration suggests metabolism is not merely supportive of virulence but intrinsically linked to pathogenic mechanisms.

  • Emergence of hybrid pathotypes: Research on hybrid E. coli strains demonstrates how genomic plasticity, potentially involving metabolic gene clusters, contributes to the emergence of new pathogenic variants with enhanced virulence . Understanding RnfE in these contexts reveals adaptation mechanisms during pathotype evolution.

  • Fundamental bioenergetic principles: The molecular mechanism of redox-driven ion pumping by the Rnf complex, with the membrane-embedded [2Fe2S] cluster playing a central role, establishes core principles applicable across diverse biological systems .

This integrated understanding bridges microbial physiology, structural biology, and infectious disease research, offering both fundamental insights and practical applications in antimicrobial development.

What collaborative research approaches would be most beneficial for advancing RnfE research in pathogenic E. coli strains?

Advancing RnfE research in pathogenic E. coli strains, particularly O139:H28, would benefit most from multidisciplinary collaborative approaches:

  • Structural-functional integration: Collaborations between structural biologists and biochemists can connect high-resolution structures with functional assays to elucidate the molecular mechanisms of RnfE within the Rnf complex .

  • Pathogenesis-metabolism nexus: Partnerships between infectious disease researchers and metabolic biochemists can reveal how RnfE function integrates with virulence mechanisms during infection .

  • Comparative genomics networks: Collaborations studying diverse E. coli strains can identify patterns in rnfE genetic variation and correlate these with functional adaptations and pathogenic potential .

  • Host-microbe interaction consortia: Multi-institutional teams can develop sophisticated infection models to study RnfE expression and function during different stages of host colonization.

  • Synthetic biology approaches: Engineering partnerships can develop tunable expression systems for RnfE to assess dosage effects and functional thresholds.

  • Computational biology integration: Combining experimental data with computational modeling can predict ion pathways, conformational changes, and interaction networks involving RnfE.

  • Translational research initiatives: Collaborations between basic scientists and clinical researchers can assess the relevance of RnfE as a biomarker or therapeutic target in E. coli infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.