Recombinant Escherichia coli O139:H28 Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
frdC; EcE24377A_4711; Fumarate reductase subunit C; Fumarate reductase 15 kDa hydrophobic protein; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Escherichia coli O139:H28 (strain E24377A / ETEC)
Target Names
frdC
Target Protein Sequence
MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGF VDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVA TIVILFVALYW
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate: fumarate reductase (used in anaerobic growth) and succinate dehydrogenase (used in aerobic growth). Fumarate reductase subunit C (FrdC) anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links
Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Fumarate reductase subunit C (frdC) in Escherichia coli?

Fumarate reductase subunit C (frdC) serves as an essential membrane anchor protein in the fumarate reductase complex of E. coli. The complete fumarate reductase complex consists of four subunits (FRD A, B, C, and D), with FRD C specifically required for membrane association of the enzyme complex and for the oxidation of reduced quinone analogues. Research has definitively demonstrated that both FRD C and FRD D are essential for proper membrane localization of the fumarate reductase complex, which is critical for anaerobic respiration using fumarate as the terminal electron acceptor .

The membrane-associated nature of frdC enables the correct positioning of the catalytic components (FRD A and B) to participate in the electron transport chain. This positioning is vital for the function of fumarate reductase in anaerobic energy metabolism, allowing E. coli to grow in environments where oxygen is unavailable by using alternative electron acceptors like fumarate .

How does the frd operon structure relate to fumarate reductase function in E. coli?

The frd operon in E. coli consists of four genes (frdA, frdB, frdC, and frdD) that encode the four subunits of the fumarate reductase complex. The functional significance of this operon structure has been experimentally demonstrated through complementation studies with E. coli strain MI1443, which lacks a chromosomal frd operon and is consequently unable to grow anaerobically on glycerol and fumarate .

Research has shown that:

  • Introduction of all four fumarate reductase subunits into E. coli MI1443 is essential for restoring anaerobic growth.

  • The FRD A and FRD B proteins form a functional dimer that is active in the benzyl viologen oxidase assay, but neither subunit alone shows activity.

  • Both FRD C and FRD D are required for membrane association of fumarate reductase and for the oxidation of reduced quinone analogues.

  • Introducing frdABC and frdD genes on separate plasmid vectors fails to restore anaerobic growth, indicating that the physical proximity of frdC and frdD genes is critical for proper expression and assembly of a functional complex .

These findings highlight the importance of maintaining the integrity of the operon structure for proper fumarate reductase function.

What is the significance of E. coli serotype O139:H28 in research contexts?

E. coli serotype O139:H28 has particular significance in research contexts due to its distinct plasmid profile and expression of specific virulence factors. Studies have established that E. coli strain E24377 of serotype O139:H28 carries plasmids that encode multiple virulence factors, including heat-stable and heat-labile enterotoxins, and surface antigens such as CS3 .

The O139 serotype is also notable for its association with specific fimbrial expression patterns. Research has shown that O139-serotyped strains typically express F18ab fimbriae, which are important adhesion factors in enterotoxigenic E. coli (ETEC) infections . This serotype has been extensively studied for its role in animal ETEC infections, particularly in pigs, where age-dependent colonization and diarrhea have been observed.

Understanding the specific characteristics of this serotype is essential for researchers studying plasmid transfer, virulence factor expression, and host-pathogen interactions in E. coli.

What methodological approaches are most effective for constructing recombinant E. coli O139:H28 expressing functional frdC?

Constructing recombinant E. coli O139:H28 with functional frdC expression requires careful consideration of several methodological factors. Based on established research protocols, the following approach has proven effective:

  • Plasmid Selection and Construction: Select a suitable vector that allows for stable maintenance in E. coli O139:H28. Research has shown that recombinant plasmids carrying portions of the E. coli frd operon can be constructed and functionally expressed through in vivo complementation . When designing the construct, ensure that all four fumarate reductase subunits are included on the same plasmid, as separation of frdC and frdD on different vectors has been demonstrated to prevent functional assembly of the fumarate reductase complex .

  • Regulatory Element Integration: Include appropriate regulatory sequences to ensure proper expression. Studies with E. coli strain E24377 (O139:H28) have demonstrated that regulatory sequences such as those homologous to cfaD or rns are essential for the expression of certain plasmid-encoded surface antigens . For frdC expression, the native regulatory elements of the frd operon should be maintained to ensure proper coordination with anaerobic growth conditions.

  • Transformation and Selection: Use electroporation or chemical transformation methods optimized for E. coli O139:H28, followed by selection on appropriate media containing antibiotics corresponding to the plasmid's resistance markers. For functional validation, transformants should be tested for anaerobic growth on glycerol and fumarate medium, as this phenotype directly correlates with functional fumarate reductase activity .

  • Expression Verification: Confirm frdC expression through Western blotting, enzymatic assays for fumarate reductase activity, or complementation of an frd-deficient strain. The benzyl viologen oxidase assay has been successfully used to verify the activity of recombinant fumarate reductase complexes .

What are the structural interactions between frdC and frdD that enable proper membrane association of the fumarate reductase complex?

The structural interactions between frdC and frdD subunits are critical for proper membrane association and function of the fumarate reductase complex. Although detailed structural information specific to E. coli O139:H28 fumarate reductase is limited in the provided search results, significant insights can be derived from fundamental research on E. coli fumarate reductase:

  • Co-dependent Membrane Integration: Research has conclusively demonstrated that both frdC and frdD are required together for membrane association of the fumarate reductase complex and for the oxidation of reduced quinone analogues . Neither subunit alone is sufficient for proper membrane localization.

  • Functional Assembly Requirements: Studies have shown that separating the DNA coding for frdC and frdD proteins affects the ability of fumarate reductase to assemble into a functional complex . This suggests that co-translational or closely coordinated expression of these two subunits may be necessary for proper folding and interaction.

  • Quinone Binding Site Formation: The interaction between frdC and frdD is believed to create binding sites for quinones, essential for electron transfer during anaerobic respiration. Experimental evidence shows that both subunits are required for the oxidation of reduced quinone analogues .

  • Anchoring of Catalytic Subunits: The frdC-frdD membrane anchor complex provides the attachment point for the catalytically active frdA-frdB dimer. The proper assembly of this four-subunit complex is essential for enzyme function, as demonstrated by the requirement of all four subunits for restoration of anaerobic growth in complementation studies .

What are the most effective protocols for measuring fumarate reductase activity in recombinant E. coli O139:H28?

Measuring fumarate reductase activity in recombinant E. coli O139:H28 requires specialized assays that target either the intact cells or isolated enzyme complexes. Based on established research methodologies, the following protocols are recommended:

Table 1: Comparative Analysis of Fumarate Reductase Activity Assay Methods

Assay MethodSample TypePrincipleAdvantagesLimitations
Benzyl Viologen Oxidase AssayCell extractsMeasures oxidation of reduced benzyl viologen coupled to fumarate reductionEstablished method with demonstrated efficacy for FRD A-B dimer Requires cell disruption; may not reflect in vivo activity
Anaerobic Growth AssayIntact cellsMeasures ability of cells to grow anaerobically using glycerol and fumarateDirectly correlates with functional fumarate reductase in vivo Qualitative rather than quantitative; time-consuming
Quinone Analogue OxidationMembrane preparationsMeasures ability of fumarate reductase to oxidize reduced quinone analoguesDirectly assesses natural electron donor interaction Requires membrane isolation; technically challenging
Oxygen Consumption InhibitionIntact cellsMeasures decrease in oxygen consumption upon fumarate addition in microaerobic conditionsNon-destructive; can use intact cellsIndirect measure; affected by other respiratory pathways

Protocol Recommendations:

  • For Quick Screening: The anaerobic growth assay on glycerol and fumarate medium provides a straightforward method to confirm functional fumarate reductase activity. This has been successfully used in complementation studies with E. coli strains lacking chromosomal frd operon .

  • For Quantitative Analysis: The benzyl viologen oxidase assay remains the gold standard for quantitative measurement. Prepare cell extracts by sonication or French press disruption, then measure the oxidation of reduced benzyl viologen (monitored at 578 nm) coupled to fumarate reduction. This method has proven effective for measuring the activity of recombinant fumarate reductase, specifically the FRD A-B dimer .

  • For Membrane Association Studies: Isolate membrane fractions through differential centrifugation and assess the distribution of fumarate reductase activity between membrane and soluble fractions. Both FRD C and FRD D are required for proper membrane association, making this a critical measurement for studies focusing on these subunits .

What strategies can be employed to optimize frdC expression while minimizing metabolic burden in recombinant systems?

Optimizing frdC expression while minimizing metabolic burden requires balancing expression levels with host cell physiology. Based on research findings, the following strategies are recommended:

  • Inducible Expression Systems: Implement tightly regulated inducible promoters to control frdC expression. This allows for cell growth to reach optimal density before inducing protein expression, thereby reducing the metabolic impact during the growth phase. Common systems include:

    • IPTG-inducible lac-based promoters

    • Arabinose-inducible araBAD promoter

    • Tetracycline-responsive elements

  • Growth Condition Optimization: Leverage the natural regulation of the frd operon, which responds to anaerobic conditions. Research has established that fumarate reductase expression is naturally upregulated during anaerobic growth . Therefore, a gradual transition from aerobic to anaerobic conditions can provide natural induction while minimizing stress.

  • Codon Optimization: Analyze and adjust the codon usage in the frdC gene to match the preferred codons of E. coli O139:H28, thereby improving translation efficiency without necessitating increased mRNA levels.

  • Balanced Subunit Expression: Ensure coordinated expression of all four fumarate reductase subunits. Research has demonstrated that all four subunits (FRD A, B, C, and D) must be present for functional enzyme assembly . Imbalanced expression can lead to accumulation of partially assembled complexes, increasing cellular stress.

  • Media and Growth Parameter Adjustment: Optimize culture conditions including:

    • Carbon source selection

    • Growth temperature (lower temperatures can reduce protein aggregation)

    • pH maintenance

    • Supplementation with specific ions or cofactors needed for fumarate reductase assembly

  • Two-Phase Cultivation Strategy: Implement a two-phase approach where biomass is generated under optimal growth conditions (aerobic), followed by a production phase with conditions optimized for fumarate reductase expression and activity (anaerobic with fumarate).

How can genetic sequence variations in the frdC gene of E. coli O139:H28 be identified and characterized?

Identifying and characterizing genetic sequence variations in the frdC gene of E. coli O139:H28 requires a systematic approach combining molecular techniques and bioinformatic analysis. While the search results don't specifically address frdC sequence variation in E. coli O139:H28, lessons can be drawn from similar analyses of genetic variation in E. coli virulence factors:

Table 2: Methodological Approaches for frdC Sequence Variation Analysis

TechniqueApplicationData GeneratedAnalysis Method
PCR Amplification and SequencingInitial identification of sequence variationsComplete frdC sequence from multiple isolatesDirect sequence comparison using alignment tools
Comparative GenomicsContextualizing variations within strainsIdentification of conserved vs. variable regionsPhylogenetic analysis and sequence conservation mapping
Site-Directed MutagenesisFunctional validation of identified variationsActivity data for variant proteinsStructure-function correlation analysis
RNA-SeqExpression analysis of variantsTranscriptional profilesDifferential expression analysis
Protein Structure PredictionImpact assessment of amino acid substitutionsPredicted structural changesMolecular dynamics simulations

Recommended Approach:

  • Strain Collection and Sequencing: Collect multiple E. coli O139:H28 strains from different sources and sequence the frdC gene. This approach has been effective in identifying genetic variations in bacterial virulence factors, as demonstrated with the fedF gene, where sequencing of 15 clinical isolates revealed 97% identity with specific amino acid substitutions at key positions .

  • Sequence Analysis and Variant Identification: Align obtained sequences with reference frdC sequences to identify single nucleotide polymorphisms (SNPs) and other variations. For example, in studies of the fedF gene, a consistent pattern of asparagine substitution to glycine or aspartic acid at position 73 was identified across multiple clinical isolates .

  • Functional Impact Assessment:

    • Express variant forms of frdC in a strain lacking the native gene

    • Assess fumarate reductase activity using established assays

    • Evaluate membrane localization efficiency

    • Measure anaerobic growth capabilities

  • Structural Correlation: Map identified variations onto predicted or known protein structures to assess potential impacts on protein folding, membrane integration, or interaction with other fumarate reductase subunits.

  • Population Genetics Analysis: Determine the frequency and distribution of identified variants across different E. coli populations, similar to the approach used in studying F18 fimbrial variations across 37 strains from various countries .

How does the expression of frdC correlate with other virulence factors in E. coli O139:H28?

The correlation between frdC expression and virulence factors in E. coli O139:H28 represents an important area of investigation, particularly given the role of specific serotypes in pathogenicity. While direct evidence linking frdC to virulence factors in this specific serotype is limited in the provided search results, several relevant connections can be established:

  • Plasmid Co-localization Patterns: Research on E. coli strain E24377 of serotype O139:H28 has demonstrated that multiple virulence factors can be encoded on the same plasmid. For instance, plasmids encoding heat-stable and heat-labile enterotoxins along with surface antigens like CS3 have been identified in this serotype . This suggests potential co-regulation and expression coordination between different factors encoded on the same plasmid.

  • Regulatory Network Integration: The expression of surface antigens in E. coli O139:H28 is controlled by specific regulatory sequences, such as those homologous to cfaD or rns . These regulatory elements could potentially influence the expression of metabolic genes like frdC, especially under conditions that favor both virulence factor expression and anaerobic metabolism.

  • Environmental Response Coordination: Both virulence factors and fumarate reductase respond to environmental changes:

    • Virulence factors like fimbriae show age-dependent expression patterns

    • Fumarate reductase expression is upregulated under anaerobic conditions

    This suggests potential cross-talk between environmental sensing mechanisms that regulate both pathways.

  • Host-Pathogen Interaction Dynamics: During infection, E. coli encounters various microenvironments within the host, many of which are anaerobic or microaerobic. Under these conditions, both virulence factor expression and fumarate reductase activity would be advantageous for bacterial survival and pathogenicity.

To thoroughly investigate these correlations, researchers should consider implementing:

  • Transcriptomic analysis comparing frdC expression with virulence gene expression under various environmental conditions

  • Genetic studies using regulatory mutants to assess cross-regulation

  • In vivo studies examining the expression patterns during actual infection processes

What bioinformatic approaches can predict the impact of frdC mutations on fumarate reductase function?

Predicting the functional impact of frdC mutations requires sophisticated bioinformatic approaches that integrate sequence, structural, and evolutionary information. The following comprehensive strategy is recommended based on current research methodologies:

Table 3: Bioinformatic Approaches for frdC Mutation Impact Analysis

ApproachTools/MethodsData GeneratedApplication to frdC
Sequence Conservation AnalysisMultiple Sequence Alignment, ConSurf, SIFTConservation scores for each residueIdentify evolutionarily constrained regions likely critical for function
Protein Structure PredictionAlphaFold2, I-TASSER, Robetta3D structural models of wild-type and mutant frdCVisualize potential structural alterations caused by mutations
Membrane Protein Topology AnalysisTMHMM, Phobius, TOPCONSTransmembrane helix predictionsAssess if mutations alter membrane-spanning regions critical for anchoring
Protein-Protein Interaction ModelingHADDOCK, ClusProInteraction models between frdC and other fumarate reductase subunitsEvaluate if mutations disrupt essential subunit interfaces
Molecular Dynamics SimulationsGROMACS, NAMDDynamic behavior of protein in membrane environmentPredict stability changes and conformational impacts of mutations
Evolutionary Coupling AnalysisEVcouplings, RaptorX-ContactCo-evolving residue pairsIdentify residues that may be functionally linked, suggesting important interaction sites
Functional Site PredictionFTSite, SiteMapPotential binding sites and functional regionsDetermine if mutations affect quinone binding or other functional sites

Implementation Strategy:

This comprehensive approach enables researchers to prioritize mutations for experimental validation and provides mechanistic insights into how specific residues contribute to frdC function within the fumarate reductase complex.

What emerging technologies are changing our understanding of membrane-bound proteins like frdC in E. coli O139:H28?

Emerging technologies are revolutionizing our understanding of membrane-bound proteins like frdC by providing unprecedented resolution of structure, dynamics, and functional interactions. While specific applications to frdC in E. coli O139:H28 are not directly addressed in the provided search results, several cutting-edge approaches are transforming the field of membrane protein research:

  • Cryo-Electron Microscopy (Cryo-EM): This technique has overcome many limitations of traditional crystallography for membrane proteins, enabling visualization of proteins in their native membrane environment without crystallization. For multi-subunit complexes like fumarate reductase, Cryo-EM could reveal the precise arrangement of all four subunits, including the membrane-embedded frdC and frdD components that are essential for proper assembly and function .

  • Single-Particle Analysis: Combined with Cryo-EM, this approach allows for visualization of different conformational states of the fumarate reductase complex, potentially revealing dynamic changes during the catalytic cycle and interactions with electron donors.

  • In-Cell NMR Spectroscopy: This technique enables the study of protein structure and dynamics within living cells, providing insights into how the natural cellular environment influences frdC folding, membrane integration, and interactions with other fumarate reductase subunits.

  • Native Mass Spectrometry: Advances in this field now allow for analysis of intact membrane protein complexes, providing information on subunit stoichiometry and stability. This could provide direct evidence for how frdC and frdD interact to form the membrane anchor for the catalytic FRD A-B dimer .

  • Integrative Structural Biology: Combining multiple structural techniques (X-ray crystallography, NMR, Cryo-EM, computational modeling) provides comprehensive structural insights that no single method can achieve alone.

  • Advanced Microscopy Techniques:

    • Super-resolution microscopy for visualizing membrane protein distribution and dynamics

    • Atomic Force Microscopy (AFM) for direct visualization and manipulation of membrane proteins in their native environment

These technologies offer unprecedented opportunities to resolve longstanding questions about frdC structure, function, and interactions within the fumarate reductase complex of E. coli O139:H28, potentially leading to new insights into bacterial metabolism and adaptations to anaerobic environments.

How might research on recombinant frdC contribute to broader understanding of E. coli adaptation to anaerobic environments?

Research on recombinant frdC has significant potential to enhance our understanding of how E. coli adapts to anaerobic environments, with implications extending beyond basic metabolism to ecological fitness, evolution, and pathogenesis. Several key areas of contribution can be identified:

  • Respiratory Flexibility Mechanisms: Studies of recombinant frdC expression and function provide insights into how E. coli modulates its respiratory pathways to adapt to oxygen limitation. The fumarate reductase complex, including frdC, is essential for anaerobic growth using fumarate as an alternative electron acceptor . Understanding the regulation, assembly, and function of this complex illuminates a fundamental adaptation strategy.

  • Host-Pathogen Interaction Dynamics: During infection, enterotoxigenic E. coli strains like O139:H28 encounter various microenvironments within the host, many of which are anaerobic. Research has shown that O139-serotyped strains typically express specific fimbriae like F18ab , but the interplay between these adhesion factors and anaerobic metabolism remains poorly understood. Recombinant frdC research could reveal how metabolic adaptation and virulence factor expression are coordinated during infection.

  • Evolutionary Conservation and Divergence: Comparative studies of frdC across E. coli strains and related species can reveal evolutionary pressures on anaerobic metabolism. Similar approaches have been productive in studying variability in fimbrial adhesins, where sequence analysis of multiple clinical isolates revealed specific patterns of conservation and variation .

  • Metabolic Network Integration: Fumarate reductase functions within a complex metabolic network. Research on frdC can illuminate how this respiratory enzyme integrates with central metabolism during anaerobic growth. The requirement for all four fumarate reductase subunits for functional activity suggests sophisticated coordination of expression and assembly that may extend to other metabolic pathways.

  • Biofilm Physiology: E. coli biofilms contain anaerobic microenvironments where fumarate reductase activity would be advantageous. Studies of frdC could reveal how respiratory flexibility contributes to biofilm formation and persistence, particularly in clinical or environmental contexts.

By advancing our understanding of these aspects of anaerobic adaptation, research on recombinant frdC contributes to fundamental knowledge of bacterial physiology while potentially informing applied fields such as infectious disease management and biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.