Recombinant Escherichia coli O139:H28 Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
frdD; EcE24377A_4710; Fumarate reductase subunit D; Fumarate reductase 13 kDa hydrophobic protein; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Escherichia coli O139:H28 (strain E24377A / ETEC)
Target Names
frdD
Target Protein Sequence
MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGIVTI
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is utilized during anaerobic growth, while succinate dehydrogenase functions in aerobic growth. FrdD anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the function of Fumarate reductase subunit D (frdD) in E. coli?

    Fumarate reductase subunit D (frdD) in Escherichia coli is a hydrophobic protein that, along with subunit C (frdC), anchors the catalytic subunits A and B to the inner surface of the cytoplasmic membrane . This anchoring is critical for the proper functioning of the complete fumarate reductase enzyme, which catalyzes the terminal step in anaerobic respiration, specifically the reduction of fumarate to succinate . Research has demonstrated that both FrdC and FrdD are required for membrane association of fumarate reductase and for the oxidation of reduced quinone analogues .

    Methodologically, studies using E. coli strain MI1443, which lacks a chromosomal frd operon, have shown that introduction of all four fumarate reductase subunits (including FrdD) is essential for restoring anaerobic growth on glycerol and fumarate, confirming the critical role of the complete complex in anaerobic metabolism . Neither the individual subunits nor incomplete complexes can support this function, highlighting the essential nature of the intact quaternary structure.

  • How is the frdD gene organized within the E. coli genome?

    The frdD gene in Escherichia coli is part of the frd operon, which encodes all four subunits of the fumarate reductase enzyme (frdA, frdB, frdC, and frdD) in a single transcriptional unit . The organization of these genes within the operon is critical for proper expression and assembly of the functional enzyme complex .

    Experimental evidence for this organizational importance comes from studies using recombinant plasmids carrying portions of the E. coli frd operon. These experiments demonstrated that introduction of the frdABC and frdD genes on two separate plasmid vectors failed to restore anaerobic growth on glycerol and fumarate in E. coli MI1443 (a strain lacking the chromosomal frd operon) . This finding indicates that the separation of the DNA coding for the FrdC and FrdD proteins affects the ability of fumarate reductase to assemble into a functional complex , highlighting the importance of genetic organization for efficient co-expression and assembly of the complete enzyme.

  • What experimental techniques are commonly used to study recombinant frdD expression?

    Several experimental techniques are commonly employed to study recombinant Fumarate reductase subunit D (frdD) expression:

    a) Recombinant Plasmid Construction: Creating plasmids containing the frdD gene, often with the entire frd operon, for expression studies .

    b) In vivo Complementation: Testing functionality by introducing expressed proteins into mutant strains (such as E. coli MI1443) that lack the chromosomal frd operon and assessing their ability to restore growth under selective conditions .

    c) Enzyme Activity Assays:

    • Benzyl viologen oxidase assay for the FrdAB dimer

    • Quinol oxidase and quinone reductase activity assays

    • Succinate:quinone oxidoreductase activity measurements

    d) Site-Directed Mutagenesis: Creating specific mutations in FrdD to analyze the functional importance of individual amino acid residues .

    e) Growth Assays: Monitoring anaerobic growth on glycerol and fumarate to assess functional complementation .

    f) Protein Expression Optimization: Using experimental design approaches to optimize expression conditions, including temperature reduction to 18°C after initial growth at 37°C, IPTG induction, and overnight expression with vigorous shaking .

    g) Membrane Vesicle Preparation: Isolating inverted membrane vesicles using techniques like French press to study the enzyme in a more native-like environment .

  • What are the optimal storage conditions for recombinant Fumarate reductase subunit D?

    Based on research with recombinant Escherichia coli O139:H28 Fumarate reductase subunit D, the following storage conditions are recommended to maintain protein stability and function :

    • Short-term storage: Working aliquots can be stored at 4°C for up to one week .

    • Medium-term storage: The protein should be stored at -20°C in an appropriate buffer .

    • Long-term storage: For extended periods, conservation at -80°C is recommended .

    • Buffer composition: Typical storage buffer consists of Tris-based buffer with 50% glycerol, optimized for this specific protein .

    • Handling precautions: Repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity .

    These storage recommendations are consistent with general practices for membrane-associated proteins, where the high glycerol concentration helps maintain protein stability and prevent aggregation during freeze-thaw cycles.

Advanced Research Questions

  • What are the critical amino acid residues in FrdD that affect quinone binding and how do mutations impact enzyme function?

    Research using site-directed mutagenesis has identified several critical amino acid residues in FrdD that play crucial roles in quinone binding and enzyme function . A comprehensive study involving 35 single-site mutations in the FrdC and FrdD polypeptides revealed that specific residues in FrdD, including Phe-57, Gln-59, Ser-60, and His-80, are essential for enzyme activity .

    The impact of mutations was assessed through functional assays measuring:

    • Quinol oxidase activity

    • Quinone reductase activity

    • Ability to support growth of E. coli DW35 (Δ frdABCD sdhC::kan) under selective conditions requiring functional enzyme

    The experimental data support a structural model where:

    • FrdD His-80 participates in a QB-type quinone binding site alongside several FrdC residues (Glu-29, Ala-32, His-82, Trp-86)

    • FrdD residues Phe-57, Gln-59, and Ser-60 form components of an apolar QA-type site

    This structural arrangement appears to be analogous to the quinone binding sites found in photosynthetic reaction centers, suggesting evolutionary conservation of quinone-binding motifs across different biological systems .

  • How does the separation of FrdC and FrdD affect the assembly and function of the fumarate reductase complex?

    Research has demonstrated that the proper assembly and function of the fumarate reductase complex requires the coordinated expression of all four subunits, with specific importance placed on the relationship between FrdC and FrdD . A crucial experimental finding showed that introducing the frdABC and frdD genes on two separate plasmid vectors failed to restore anaerobic growth on glycerol and fumarate in E. coli MI1443 (a strain lacking a chromosomal frd operon) .

    This indicates that separation of the DNA coding for the FrdC and FrdD proteins significantly impacts the enzyme's ability to assemble into a functional complex . The precise mechanism for this effect has not been fully elucidated, but likely involves:

    1. Coordinated translation of FrdC and FrdD, which may be necessary for proper insertion into the membrane

    2. Potential interactions between nascent FrdC and FrdD polypeptides during membrane insertion

    3. Stoichiometric balance between the two subunits, which may be disrupted when expressed from separate vectors

    These findings have important methodological implications for designing recombinant systems to study or produce the fumarate reductase complex. For optimal assembly and function, FrdC and FrdD should be expressed together from the same transcriptional unit, mimicking their natural organization in the frd operon.

  • How does the fumarate reductase of E. coli differ from that of other bacterial species in terms of ROS production?

    A significant difference has been observed between the fumarate reductase (Frd) of Escherichia coli and that of Bacteroides thetaiotaomicron regarding reactive oxygen species (ROS) production . This differential ROS production represents an important functional distinction with implications for bacterial oxygen tolerance.

    E. coli Fumarate Reductase and ROS Production:

    • E. coli membrane vesicles containing Frd, when incubated with succinate in oxic buffer, produce substantial amounts of both hydrogen peroxide (H₂O₂) and superoxide

    • This ROS production is dependent on the presence of Frd and varies with succinate concentration

    • At higher doses of succinate, E. coli Frd produces less superoxide as the more-reduced enzyme releases electrons to oxygen in pairs rather than singly

    • At very high doses, succinate can prevent all ROS formation by occluding the flavin

    B. thetaiotaomicron Fumarate Reductase and ROS Production:

    • Despite exhibiting similar succinate:quinone reductase activity levels, B. thetaiotaomicron vesicles treated with succinate do not generate any significant amount of either oxidant

    • The B. thetaiotaomicron enzyme does not release ROS at any concentration of succinate tested

    Importantly, the succinate:quinone oxidoreductase activities were quantitatively similar in anoxically grown E. coli and B. thetaiotaomicron, indicating similar enzyme levels . This finding contradicted the initial hypothesis that B. thetaiotaomicron might have higher Frd titers due to its central role in metabolism , suggesting structural or mechanistic differences rather than expression level differences account for the divergent ROS production.

  • What are the implications of using fumarate reductase as part of a heterologous electron transfer pathway for bioelectronic applications?

    Recent research has demonstrated the successful integration of fumarate reductase into heterologous electron transfer pathways for bioelectronic applications . A pioneering study showed that Escherichia coli expressing the Mtr pathway (mtrCAB) from Shewanella oneidensis MR-1 could consume electrons directly from a cathode when fumarate was present .

    Key Experimental Findings:

    • Fumarate-triggered current consumption occurred only when fumarate reductase was present, indicating that all electrons passed through this enzyme

    • Comparative studies with deletion strains provided evidence that cathodic electrons pass solely through FrdABCD and SdhABCD upon fumarate addition

    • The CymAMtr-ΔfrdABCD strain consumed ~40% as much current as the CymAMtr-E. coli strain, while the CymAMtr-ΔfrdABCDΔsdhABCD strain did not consume any significant current

    • Eliminating competing electron flux by deleting nuoH (Complex I component) allowed additional cathodic electrons to enter the Mtr pathway, resulting in ~225% more current consumption

    StrainCurrent Consumption (Relative to CymAMtr-E. coli)
    CymAMtr-E. coli100%
    CymAMtr-ΔfrdABCD~40%
    CymAMtr-ΔfrdABCDΔsdhABCD~0% (No significant current)
    CymAMtr-ΔnuoH~225%

    Applications for Bioelectronics:

    1. Precise Electronic Control: This system demonstrates the possibility of electronically controlling specific intracellular redox reactions in bacteria

    2. Modular Genetic Tool: The research introduces a genetic module that can reduce specific intracellular redox molecules with an electrode

    3. Biosynthetic Applications: While current consumption was not stoichiometrically related to succinate accumulation, it was stoichiometric with the reduction of nitrate to ammonia, demonstrating potential for precise control of specific biosynthetic pathways

  • What methodologies can be used to analyze the interaction between FrdD and quinones?

    Analyzing the interaction between Fumarate reductase subunit D (FrdD) and quinones requires specialized methodologies that can probe membrane protein-lipid interactions. Based on the research literature, several approaches have proven effective :

    Enzymatic Activity Assays:

    • Quinol oxidase assays to measure the oxidation of reduced quinone analogues

    • Quinone reductase assays to assess the reverse reaction

    • Monitoring succinate:quinone oxidoreductase activity

    Membrane Vesicle Studies:

    • Preparation of inverted membrane vesicles using techniques like French press

    • Measurement of succinate-dependent ROS production as an indirect measure of quinone interaction

    • Comparative analysis between wild-type and mutant enzymes

    Site-Directed Mutagenesis:

    • Creation of single-site mutations in FrdD at residues suspected to be involved in quinone binding

    • Systematic replacement of key residues (e.g., FrdD Phe-57, Gln-59, Ser-60, His-80) with amino acids having different properties

    • Functional characterization of each mutant for quinone interactions

    Electrochemical Approaches:

    • Cyclic voltammetry to measure electron transfer between electrodes and the enzyme-quinone system

    • Chronoamperometry to quantify current consumption as a measure of quinone-mediated electron transfer

    These complementary methodological approaches provide a comprehensive toolkit for investigating both structural and functional aspects of FrdD-quinone interactions in bacterial respiratory systems.

  • How can site-directed mutagenesis be used to investigate the function of specific residues in FrdD?

    Site-directed mutagenesis has been instrumental in elucidating the function of specific residues in Fumarate reductase subunit D. A methodical approach involves :

    Experimental Design Protocol:

    1. Target Selection:

      • Identify residues of interest based on sequence conservation or structural predictions

      • In FrdD, key targets have included Phe-57, Gln-59, Ser-60, and His-80

    2. Mutation Design:

      • Create mutations that alter specific properties (charge, size, hydrophobicity)

      • Example: Substituting critical histidine residues with arginine, leucine, tyrosine, or glutamic acid to test the importance of positive charge

    3. Expression System:

      • Express mutant constructs in appropriate E. coli strains

      • For fumarate reductase studies, strains lacking the chromosomal frd operon are commonly used (e.g., E. coli DW35)

    4. Functional Characterization:

      • Assess enzyme activity through multiple assays:

        • Quinol oxidase activity

        • Quinone reductase activity

        • Growth complementation under selective conditions

    Research Findings from This Approach:

    Studies using this methodology revealed that FrdD His-80 appears to participate in a QB-type quinone binding site, while FrdD Phe-57, Gln-59, and Ser-60 form components of an apolar QA-type site . These findings established a structural model of the FRD complex with quinone binding sites similar to those in photosynthetic reaction centers .

    This systematic mutational approach provided functional evidence that would have been difficult to obtain through structural studies alone, particularly for dynamic protein-lipid interactions in membrane-bound enzyme complexes.

  • What are the optimal conditions for expressing recombinant E. coli fumarate reductase subunit D in heterologous systems?

    Optimizing expression of recombinant Escherichia coli fumarate reductase subunit D requires careful consideration of several parameters :

    Expression System Design:

    • E. coli is generally the preferred host due to its simplicity, low cost, and high yield potential

    • T7 promoter-based expression systems show good results for membrane proteins

    • For proper assembly, express all four fumarate reductase subunits together, as separation of FrdC and FrdD affects complex assembly

    Optimized Expression Protocol:

    ParameterOptimal ConditionRationale
    Growth temperature37°C until mid-log phase, then reduce to 18°CLower temperature facilitates proper protein folding
    MediaLuria broth in baffled shaker flasksIncreased aeration improves yield
    InductionIPTG after temperature reductionControls expression timing for optimal folding
    Expression durationOvernight with shaking (200-250 rpm) at 18°CExtended time at lower temperature improves yield of properly folded protein
    E. coli strainLacking lon and ompT proteasesMinimizes in vivo degradation of target protein

    Storage and Handling:

    • Cell pellets can be stored at -80°C until protein extraction

    • Purified protein should be stored in Tris-based buffer with 50% glycerol at -20°C

    • Avoid repeated freeze-thaw cycles

    This optimized protocol has been shown to yield high levels of functional recombinant proteins and can serve as a starting point for expressing the hydrophobic FrdD subunit, with potential modifications based on specific experimental goals.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.