Recombinant Escherichia coli O139:H28 Inner membrane protein CbrB (cbrB)

Shipped with Ice Packs
In Stock

Description

Research Applications and Detection

CbrB is primarily used in immunological and structural studies.

Antibody-Based Detection

Polyclonal rabbit antibodies against CbrB enable its detection via:

  • ELISA: Quantitative antigen measurement .

  • Western Blot: Verification of protein expression .

Table 2: Antibodies Targeting CbrB

Antibody TypeReactivityHostApplicationsSource
Polyclonal IgGE. coli O139:H28 E24377ARabbitELISA, Western Blot
Polyclonal IgGE. coli UTI89 (UPEC)RabbitELISA, Western Blot
Polyclonal IgGShigella flexneriRabbitELISA, Western Blot

Genomic and Pathway Context

CbrB is encoded on the chromosome of E. coli O139:H28 E24377A (GenBank: CP000800) . While its direct role in pathogenesis remains unclear, it is part of the broader genomic landscape of ETEC, which includes plasmid-encoded virulence factors like CS1 and enterotoxins .

Potential in Vaccine Development

ETEC strains like O139:H28 are targets for vaccine development. While CbrB is not explicitly cited in vaccine studies, its presence in pathogenic strains and availability as a recombinant protein suggest it could serve as:

  • A diagnostic marker for strain identification .

  • A candidate antigen in multivalent vaccine strategies, particularly if its expression correlates with colonization or toxin production .

Challenges and Future Directions

  1. Functional Elucidation: Limited studies on CbrB’s role in membrane structure, stress response, or interaction with virulence factors .

  2. Cross-Reactivity: Antibodies show reactivity across E. coli and Shigella species, necessitating specificity validation .

  3. Proteomic Integration: High-throughput studies (e.g., DIA/SWATH) could profile CbrB expression under stress or nutrient limitations .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize development of the specified tag.
Synonyms
cbrB; EcE24377A_4225; Inner membrane protein CbrB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Escherichia coli O139:H28 (strain E24377A / ETEC)
Target Names
cbrB
Target Protein Sequence
MSVSRRVIHHGLYFAVLGPLIGVLFLVLYIFFAKEPLVLLVIIQVLPLFLLLSITTGAIP ALLTCVMVACLPEKIGSQKNYRCLAGGIGGVVITEIYCAVIVHIKGMASSELFENILSGD SLVVRIIPALLAGVVMSRIITRLPGLDISCPETDSLS
Uniprot No.

Target Background

Database Links
Protein Families
CbrB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are optimal for producing recombinant CbrB protein?

While multiple expression systems exist for recombinant protein production, E. coli remains the most frequently utilized host for membrane proteins like CbrB due to its rapid growth, well-characterized genetics, and cost-effectiveness . For optimal expression of CbrB, consider these methodological approaches:

  • Vector selection: pET-based expression systems utilizing T7 RNA polymerase offer tight regulation and high expression yields for membrane proteins.

  • Host strain optimization: BL21(DE3) derivatives are recommended, particularly those with modifications that address common bottlenecks in membrane protein expression:

    • C41(DE3) and C43(DE3) strains show enhanced tolerance for toxic membrane proteins

    • Rosetta strains supply rare codons that may be present in the cbrB gene

    • BL21-AI with gp2 modifications allow decoupling of cell growth from recombinant protein production

  • Culture conditions: Slower expression at reduced temperatures (16-25°C) often improves membrane protein folding and reduces inclusion body formation.

  • Induction parameters: Lower inducer concentrations and extended expression periods can significantly improve functional protein yields.

The effectiveness of these approaches must be empirically determined for CbrB, as membrane proteins often exhibit unique expression behavior requiring case-specific optimization .

How should researchers design experiments to study CbrB in its native membrane environment?

Studying CbrB in its native membrane environment requires specialized techniques that preserve the protein's natural lipid surroundings. A hybrid methodological approach combining complementary techniques provides the most comprehensive structural and functional insights:

  • Sample preparation: Generate isotopically labeled E. coli expressing CbrB, then create cell envelope particles through gentle disruption methods that preserve membrane integrity. This approach eliminates the need for detergent solubilization or reconstitution into artificial lipid systems .

  • Structural analysis: Implement a dual-technique approach:

    • Solid-state NMR spectroscopy (ssNMR): Provides atomic-level structural information and dynamics data

    • Electron cryotomography (cryoET): Delivers nanometer-scale spatial information and environmental context

  • Complementary data integration: These techniques offer synergistic information (as shown in Table 1), where ssNMR provides atomic-scale chemical information while cryoET captures the larger structural context .

Table 1: Complementary Nature of ssNMR and cryoET for Native Membrane Protein Analysis

ParameterSolid-state NMR (ssNMR)Electron Cryotomography (cryoET)
ScaleAtomic (Ångstrom)Nanometer
Measurement typeBulk measurementsIndividual events
Temporal resolutionIncludes motion and dynamicsSnapshots (seconds to hours)
Information typeChemical information (atomic)Spatial information (nanometer)
Background signalExcluded via isotope labelingRecords full environment
Sample stateFrozen or at physiological temperatureVitrified (frozen)

This hybrid approach maintains the protein in its native membrane context while providing complementary structural information across different scales .

What are the optimal conditions for storing and handling recombinant CbrB protein?

Proper storage and handling of CbrB is critical for maintaining protein stability and functionality. Follow these research-validated protocols:

  • Short-term storage: Working aliquots of purified CbrB can be maintained at 4°C for up to one week when stored in appropriate buffer conditions .

  • Long-term storage: For extended preservation, store protein at -20°C, with ultra-long-term storage at -80°C recommended. The protein should be maintained in a Tris-based buffer supplemented with 50% glycerol, which has been optimized specifically for CbrB stability .

  • Freeze-thaw considerations: Repeated freeze-thaw cycles should be strictly avoided as they can significantly compromise membrane protein integrity. Prepare single-use aliquots prior to freezing .

  • Buffer composition: The storage buffer composition should be specifically tailored to CbrB, with considerations for:

    • pH stability (typically 7.4-8.0)

    • Ionic strength for solubility

    • Presence of stabilizing agents (glycerol)

    • Optional addition of mild non-denaturing detergents if the protein has been extracted from membranes

These handling protocols have been established through empirical testing and are essential for maintaining CbrB in its native conformation for downstream structural and functional analyses .

What techniques are most effective for determining the membrane topology of CbrB?

Elucidating the membrane topology of CbrB requires a multi-faceted approach that combines computational predictions with experimental validation:

  • Computational prediction methods:

    • Hydropathy analysis using Kyte-Doolittle or similar algorithms to identify transmembrane regions

    • Machine learning-based topology prediction tools like TMHMM, TOPCONS, or DeepTMHMM

    • Evolutionary coupling analysis to identify conserved interaction interfaces

  • Experimental validation techniques:

    • Cysteine scanning mutagenesis: Systematically introduce cysteine residues throughout the protein sequence and assess their accessibility to membrane-impermeable thiol-reactive reagents

    • Reporter fusion analysis: Create fusions with reporter proteins (GFP, PhoA, LacZ) at different positions to determine cytoplasmic versus periplasmic localization

    • Protease protection assays: Determine which regions are protected from protease digestion by the membrane

  • Advanced structural techniques:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identifies solvent-accessible regions versus membrane-protected domains

    • Site-directed spin labeling coupled with electron paramagnetic resonance (EPR): Provides distance constraints and environmental information

Integration of these approaches allows researchers to generate a comprehensive model of how CbrB is oriented within the inner membrane, identifying which regions face the cytoplasm, which span the membrane, and which may extend into the periplasmic space .

How can researchers address the challenges of obtaining high-resolution structural data for CbrB?

Membrane proteins like CbrB present significant challenges for structural determination. A methodical research approach should address these challenges through:

  • Expression optimization for structural studies:

    • Implement selective isotopic labeling strategies (13C, 15N) for NMR studies

    • Establish uniform expression conditions that maximize protein homogeneity

    • Consider fusion partners that enhance expression while maintaining native structure

  • Purification strategies preserving native structure:

    • Evaluate multiple detergents to identify those that maintain CbrB stability

    • Implement stringent quality control checkpoints throughout purification

    • Consider amphipol or nanodisc technologies for detergent-free stabilization

  • Hybrid structural analysis approaches:

    • Combine data from X-ray crystallography, cryo-EM, and NMR for integrated structural models

    • Implement computational molecular dynamics simulations anchored by experimental constraints

    • Apply cross-linking mass spectrometry to validate predicted structural features

  • Novel native membrane approaches:

    • Develop protocols for rifampicin-treated bacteria to produce cell envelope particles suitable for both ssNMR and cryoET analysis

    • Implement 1H-detected magic angle spinning techniques for enhanced sensitivity in ssNMR studies

    • Establish subvolume averaging protocols for cryoET data to improve resolution

These methodological strategies collectively enhance the probability of obtaining reliable structural information for challenging membrane proteins like CbrB, while maintaining them in environments that closely mimic their native state .

What experimental designs best elucidate the physiological role of CbrB in E. coli?

Determining the physiological role of CbrB requires a systematic research approach combining genetic, biochemical, and physiological methodologies:

  • Gene knockout and complementation studies:

    • Generate precise ΔcbrB deletion mutants using CRISPR-Cas9 or lambda Red recombination

    • Perform phenotypic profiling under various growth conditions (temperature, pH, osmolarity)

    • Conduct complementation with wild-type and mutant variants to confirm phenotype specificity

  • Interactome analysis:

    • Implement bacterial two-hybrid screening to identify protein interaction partners

    • Perform co-immunoprecipitation studies coupled with mass spectrometry

    • Utilize proximity labeling approaches (BioID, APEX) to identify neighboring proteins in the membrane

  • Transcriptomic and metabolomic profiling:

    • Compare RNA-seq data between wild-type and ΔcbrB strains

    • Identify metabolic pathways altered in the absence of CbrB

    • Evaluate membrane-associated metabolite changes

  • Physiological stress response testing:

    • Assess antimicrobial susceptibility profiles in the presence/absence of CbrB

    • Evaluate membrane integrity under various stress conditions

    • Measure proton motive force and ion flux changes in mutants versus wild-type

How does the function of CbrB relate to pathogenicity in E. coli O139:H28?

Understanding the relationship between CbrB and pathogenicity requires investigations that connect molecular function to virulence:

  • Virulence phenotype analysis:

    • Compare adhesion, invasion, and persistence capabilities between wild-type and ΔcbrB mutants

    • Assess biofilm formation capacity, as membrane proteins often contribute to this virulence-associated phenotype

    • Evaluate host immune response elicitation by wild-type versus mutant strains

  • Regulation within virulence networks:

    • Determine if CbrB expression changes during infection processes

    • Identify if CbrB is co-regulated with established virulence factors

    • Establish the regulatory hierarchy through transcription factor binding and reporter assays

  • Host-pathogen interaction studies:

    • Assess CbrB's role in colonization using tissue culture models

    • Evaluate contribution to transmissibility between hosts

    • Determine if CbrB affects antimicrobial resistance profiles relevant to pathogenesis

  • Comparative genomics approach:

    • Analyze the conservation and variation of CbrB across pathogenic and non-pathogenic E. coli strains

    • Identify strain-specific adaptations in the protein sequence

    • Correlate genetic variations with virulence phenotypes

This multi-faceted approach can determine whether CbrB functions as a traditional virulence factor or as a fitness factor that indirectly enhances pathogenicity through improved colonization, environmental persistence, or stress resistance . The research should specifically address how CbrB contributes to the distinctive characteristics of the O139:H28 serotype.

How can recombinant CbrB be used in structural vaccinology approaches?

Recombinant CbrB protein offers potential applications in structural vaccinology through the following research framework:

  • Epitope mapping and immunogenicity assessment:

    • Identify surface-exposed regions of CbrB using the structural data

    • Evaluate conservation of these regions across pathogenic E. coli strains

    • Assess immunogenicity of full-length CbrB and derived peptides

  • Vaccine candidate design:

    • Generate recombinant constructs containing immunogenic epitopes

    • Engineer soluble variants that maintain critical conformational epitopes

    • Develop glycosylated versions utilizing engineered E. coli glycosylation pathways to enhance immunogenicity

  • Delivery system optimization:

    • Evaluate incorporation into outer membrane vesicles (OMVs)

    • Assess presentation on virus-like particles

    • Develop nanodisc formulations that present CbrB in a membrane-like environment

  • Immunoprotection evaluation:

    • Design challenge studies to assess protection against pathogenic E. coli

    • Determine correlates of protection through serological analysis

    • Evaluate cross-protection against heterologous strains

This structural vaccinology approach leverages detailed knowledge of CbrB structure to rationally design vaccine components that target conserved, accessible epitopes, potentially offering protection against pathogenic E. coli strains .

What are the challenges and solutions in studying CbrB protein-protein interactions within the bacterial membrane?

Investigating membrane protein interactions presents unique methodological challenges that require specialized approaches:

  • In vivo interaction mapping challenges:

    • Traditional yeast two-hybrid systems are ineffective for membrane proteins

    • Co-immunoprecipitation can disrupt native membrane interactions

    • Ensuring physiological relevance of detected interactions is difficult

  • Methodological solutions:

    • Modified split-protein complementation assays: Adaptations of DHFR, ubiquitin, or luciferase complementation systems optimized for membrane proteins

    • FRET/BRET approaches: Using fluorescent or bioluminescent protein pairs to detect proximity in living cells

    • In vivo cross-linking: Utilizing photo-activatable or chemical cross-linkers to capture transient interactions

  • Advanced technological approaches:

    • Native mass spectrometry: Specialized methods for membrane protein complexes

    • Single-molecule techniques: Tracking protein dynamics and interactions in native membranes

    • Correlative light and electron microscopy (CLEM): Combining fluorescence localization with ultrastructural context

  • Data analysis considerations:

    • Implementing statistical methods to distinguish specific from non-specific interactions

    • Developing computational models that account for membrane constraints

    • Integrating interaction data with structural information

Table 2: Comparison of Methods for Studying Membrane Protein Interactions

MethodSpatial ResolutionTemporal ResolutionIn Vivo CapabilityTechnical DifficultyMembrane Context Preservation
Split-protein complementationLowMinutesHighMediumHigh
FRET/BRETMedium (1-10 nm)SecondsHighHighHigh
Cross-linking MSHighSnapshotMediumHighMedium
Native MSHighSnapshotNoVery HighLow
cryoETMedium-HighSnapshotNoVery HighHigh
ssNMRAtomicVariableNoVery HighHigh

By integrating multiple complementary approaches, researchers can overcome the inherent challenges of studying membrane protein interactions while maintaining them in contexts that reflect their native environment .

How should researchers design experiments to address the metabolic burden during recombinant CbrB expression?

The metabolic burden associated with heterologous protein expression represents a complex challenge that requires methodical experimental approaches:

  • Experimental design parameters:

    • Implement Completely Random Design (CRD) to assess expression variables, ensuring homogeneous experimental units and proper randomization of treatments

    • Carefully determine sample sizes using power analysis to detect meaningful differences

    • Include appropriate controls for growth rate, plasmid maintenance, and host adaptation

  • Measurement approaches:

    • Transcriptomic profiling: RNA-seq to identify stress responses and metabolic adaptations

    • Metabolic flux analysis: Isotope labeling to track changes in central carbon metabolism

    • Growth kinetics monitoring: High-resolution growth curves under varying induction conditions

    • Ribosome engagement assays: Ribosome profiling to assess translation burden

  • Mitigation strategies testing:

    • Evaluate decoupling cell growth from protein production using T7 RNA polymerase and phage-derived inhibitor peptide systems

    • Test defined feeding strategies to prevent metabolite limitations

    • Assess co-expression of chaperones and other folding modulators

  • Statistical analysis approach:

    • Apply multi-factorial ANOVA to identify significant variables and interactions

    • Implement regression modeling to predict optimal expression conditions

    • Utilize principal component analysis to reduce dimensionality of complex datasets

This systematic approach addresses the "metabolic burden" question that remains partially elusive despite extensive research, as noted in recent literature where experimental results often appear contradictory . The framework enables researchers to quantify and potentially overcome the metabolic constraints limiting recombinant CbrB production.

What contradictions exist in the literature regarding membrane protein expression, and how can research designs address these?

Several significant contradictions exist in the literature regarding membrane protein expression that require careful experimental design to resolve:

  • Contradictory findings on expression optimization:

    • Some studies suggest that reduced expression rates improve membrane protein yield and quality

    • Contrary research demonstrates success with high-expression systems yielding "several hundreds of mg/L" of functional membrane proteins

    • Resolution approach: Design factorial experiments explicitly testing the interaction between expression rate and membrane integration capacity

  • Divergent models of metabolic burden:

    • Some researchers propose that metabolite shortages limit recombinant expression

    • Others suggest that inhibition of host physiological metabolism causes bacterial decline

    • T7 RNA polymerase heterogeneity has contradictory reported effects

    • Resolution approach: Implement metabolomic profiling alongside expression studies to directly measure metabolite pools during expression

  • Conflicting data on membrane mimetics:

    • Literature disagrees on the optimal membrane mimetic for maintaining native structure

    • Some studies favor detergent solubilization while others emphasize native membranes

    • Resolution approach: Compare multiple membrane environments within the same study using identical structural and functional assays

  • Design framework for addressing contradictions:

    • Implement systematic parameter testing rather than optimizing single variables

    • Conduct parallel experiments in multiple E. coli strains to determine strain-specific effects

    • Develop standardized reporting formats for expression conditions to enable meta-analysis

    • Utilize the strengths of complementary methods like ssNMR and cryoET to validate findings across different techniques

These experimental approaches can help resolve contradictions by directly testing competing hypotheses under controlled conditions, potentially leading to a more unified understanding of membrane protein expression dynamics .

How might artificial intelligence tools enhance CbrB structural and functional studies?

Artificial intelligence approaches offer transformative potential for membrane protein research through several methodological implementations:

  • Structure prediction and refinement:

    • AI tools like AlphaFold2 and RoseTTAFold provide unprecedented accuracy in predicting membrane protein structures

    • Hybrid approaches combining limited experimental data with AI predictions can resolve ambiguities in CbrB structure

    • Implementation strategy: Generate multiple AI-predicted models, then validate specific structural elements using targeted experimental approaches

  • Functional annotation enhancement:

    • Deep learning models trained on multiple protein characteristics can predict functional sites

    • Graph neural networks can identify non-obvious relationships between sequence, structure, and function

    • Implementation strategy: Develop specialized models incorporating membrane protein-specific features like lipid interactions and transmembrane topology

  • Experimental design optimization:

    • Machine learning algorithms can predict optimal expression conditions based on protein sequence features

    • Bayesian optimization approaches can efficiently navigate the large parameter space of expression conditions

    • Implementation strategy: Implement active learning frameworks that iteratively improve predictions through targeted experiments

  • Data integration platforms:

    • AI systems can integrate heterogeneous data from multiple experimental techniques

    • Natural language processing can extract relevant information from the scientific literature

    • Implementation strategy: Develop knowledge graphs specifically for membrane proteins that connect experimental findings across multiple scales

As noted in recent literature, AI tools hold promise for clarifying complex issues in recombinant protein production, though their training will "require more systematic experimental approaches to collect sufficiently uniform data" . This highlights the need for standardized experimental protocols to generate the consistent datasets needed for effective AI application.

What glycoengineering approaches might improve the functional properties of recombinant CbrB?

Recent advances in bacterial glycoengineering open new possibilities for enhancing recombinant membrane proteins through post-translational modifications:

  • O-linked glycosylation strategies:

    • Implement engineered E. coli systems with O-glycosylation machinery capable of functionalizing serine residues

    • Target specific glycosylation sites within CbrB based on structural accessibility

    • Research approach: Test multiple human cancer-associated glycans that have demonstrated reliability in previous studies

  • N-linked glycosylation approaches:

    • Utilize E. coli transformed with Campylobacter-derived PglB oligosaccharyltransferase

    • Optimize signal peptide cleavage sites to extend membrane residency time

    • Research approach: Fine-tune oxidation parameters to enhance glycosylation efficiency

  • Advanced humanized glycosylation platforms:

    • Implement recently developed platforms for producing humanized N-glycosylated recombinant proteins

    • Systematically evaluate glycoform heterogeneity and its impact on protein function

    • Research approach: Compare multiple glycoengineering strategies within the same experimental framework

  • Functional impact assessment:

    • Evaluate how different glycosylation patterns affect membrane integration and topology

    • Assess impacts on protein stability, trafficking, and interaction networks

    • Research approach: Develop quantitative assays that directly measure the functional consequences of specific glycosylation patterns

These glycoengineering approaches represent a significant advance beyond traditional recombinant expression, potentially enhancing CbrB stability and functionality through post-translational modifications that more closely mimic eukaryotic processing systems .

What are the most promising future research directions for CbrB membrane protein studies?

The field of membrane protein research, particularly for proteins like CbrB, is poised for significant advances through several emerging research directions:

  • Integration of native membrane structural biology approaches:

    • Further development of complementary techniques like ssNMR and cryoET

    • Advancement of methods that preserve the native lipid environment

    • Expected impact: More accurate structural models that capture physiologically relevant conformational states

  • Systems biology integration:

    • Connecting CbrB function to broader membrane protein networks

    • Understanding how membrane proteome organization influences bacterial physiology

    • Expected impact: Contextualizing individual protein functions within cellular adaptations and pathogenicity

  • Synthetic biology applications:

    • Engineering CbrB variants with enhanced or novel functions

    • Developing CbrB-based biosensors or cellular engineering tools

    • Expected impact: New biotechnological applications leveraging membrane protein biology

  • Cross-disciplinary methodological advances:

    • Implementation of microfluidic approaches for membrane protein studies

    • Development of high-throughput screening methods for membrane protein variants

    • Expected impact: Acceleration of experimental workflows and expanded parameter testing

These research directions collectively will provide a more comprehensive understanding of membrane proteins like CbrB, potentially revealing new therapeutic targets and biotechnological applications while addressing fundamental questions about membrane protein biology and bacterial physiology .

How can researchers address the methodological challenges in comparative studies between CbrB and related membrane proteins?

Comparative studies between CbrB and related membrane proteins face significant methodological challenges that require systematic research approaches:

  • Standardization challenges:

    • Different membrane proteins often require distinct expression and purification conditions

    • Structural analysis techniques may perform differently across protein classes

    • Solution approach: Develop core protocols with protein-specific optimization modules to maintain comparability

  • Experimental design considerations:

    • Implement Completely Random Design (CRD) with sufficient replication to account for protein-specific variability

    • Ensure experimental units (bacterial cultures, purified protein preparations) are truly homogeneous

    • Control for expression level differences that may confound functional comparisons

  • Multi-method validation framework:

    • Apply complementary structural methods to each protein (ssNMR, cryoET, X-ray crystallography)

    • Validate functional assays using multiple readouts for each protein

    • Implement standardized scoring systems for quality control across protein preparations

  • Data integration strategies:

    • Develop computational frameworks that normalize data across different experimental platforms

    • Implement Bayesian approaches that incorporate prior knowledge about protein families

    • Utilize machine learning for pattern recognition across diverse datasets

Table 3: Methodological Approaches for Comparative Membrane Protein Studies

ChallengeTraditional ApproachImproved MethodologyExpected Benefit
Expression variabilityOptimize each protein separatelyStandardized vector systems with variable promoter strengthsNormalized expression levels
Purification differencesProtein-specific protocolsCore protocol with standardized quality metricsComparable purity and activity
Structural heterogeneitySingle-technique analysisMulti-technique validationMore robust structural comparisons
Functional variabilitySingle assay systemsMultiple complementary assaysComprehensive functional profiles
Data comparabilityDescriptive comparisonsQuantitative scoring systemsStatistical comparability across studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.