Recombinant Escherichia coli O139:H28 Large-conductance mechanosensitive channel (mscL)

What is the molecular structure of E. coli O139:H28 MscL?

The E. coli O139:H28 MscL protein consists of 136 amino acids with the sequence: MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEVLLTEIRDLLKEQNNRS . While a high-resolution structure of E. coli MscL is still being refined, structural studies on the homologous Mycobacterium tuberculosis MscL (TbMscL) have revealed a homopentameric arrangement with each subunit containing two transmembrane domains (TM1 and TM2), a cytoplasmic helical bundle (S1), and a periplasmic loop . The channel forms one of the largest biological pores known, with a diameter exceeding 25 Å when fully open .

How does the MscL channel respond to mechanical stimuli?

MscL responds to increased membrane tension by undergoing a conformational change that opens the channel pore. This mechanosensitivity is preserved when the channel is reconstituted into lipid bilayers, demonstrating that activation depends solely on tension in the lipid bilayer rather than interactions with other cellular components . The channel's pressure sensitivity is modulated by properties of the lipid environment, including bilayer thickness, membrane stiffness, and spontaneous curvature of the lipid monolayer . The gating mechanism involves movement of transmembrane helices that leads to expansion of the pore, allowing the passage of ions and small molecules to relieve osmotic pressure in bacterial cells .

What are the functional differences between MscL and other mechanosensitive channels?

MscL is distinguished from other mechanosensitive channels by its exceptionally large conductance (approximately 3 nS) and high activation threshold. Unlike the smaller MscS (Small conductance mechanosensitive channel), MscL requires greater membrane tension to open and forms a larger pore that can allow passage of molecules up to 30 Da, including small proteins and peptides . While MscS shows some ion selectivity, MscL is non-selective and permits passage of both cations and anions. Additionally, MscL's S1 amphipathic helix is directly connected to the pore-lining segment, which is not the case for other mechanosensitive channels . This structural difference contributes to MscL's unique gating properties and tension sensitivity.

What expression systems are optimal for producing functional recombinant MscL?

For functional recombinant MscL expression, E. coli expression systems have proven most effective, particularly when using strains with disrupted chromosomal mscL genes to prevent background interference . Expression can be achieved using plasmid vectors containing MscL as a fusion protein with tags like glutathione S-transferase (GST) . For controlled expression levels, chromosomal integration of the mscL gene is preferable over plasmid-based systems, as it minimizes variation in channel expression across the population and provides conditions more representative of native cell physiology . When creating fluorescent fusion constructs for visualization studies, superfolder GFP (sfGFP) has been successfully fused to MscL without compromising channel functionality . For mammalian cell studies, MscL has been functionally expressed while maintaining mechanosensitivity in mammalian cell membranes .

What is the optimal purification protocol for maintaining MscL functionality?

A successful purification protocol for functional MscL involves:

• Expression of MscL as a fusion protein with glutathione S-transferase (GST)

• Cell lysis and membrane solubilization using appropriate detergents

• Affinity purification using glutathione-coated beads

• Specific cleavage of the fusion protein using thrombin to recover purified MscL

• Reconstitution into artificial liposomes using appropriate lipid compositions

This approach yields MscL protein that retains full functionality when examined with patch-clamp techniques, exhibiting characteristic conductance and pressure sensitivity. The purified protein should be stored in a Tris-based buffer containing 50% glycerol at -20°C for regular storage or -80°C for extended storage . Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided to preserve functionality .

How can researchers verify the functionality of purified recombinant MscL?

Verification of MscL functionality requires multiple complementary approaches:

• Electrophysiological characterization: Patch-clamp analysis of reconstituted MscL in liposomes to confirm characteristic conductance (~3 nS), pressure sensitivity, and response to known inhibitors like gadolinium .

• Response to membrane tension modifiers: Testing channel activation in response to amphipaths like lysophosphatidylcholine (LPC) that alter membrane tension .

• Inhibition tests: Confirming that anti-MscL polyclonal antibodies abolish channel activity when preincubated with the MscL protein .

• In vivo complementation: For MscL variants, demonstrating protection against osmotic downshock in MscL-deficient bacterial strains .

• Structural integrity assessment: Using techniques like circular dichroism, FRET, or EPR spectroscopy to confirm proper folding and conformational changes upon activation .

What spectroscopic methods can be used to study MscL conformational changes?

Multiple spectroscopic approaches have proven valuable for examining MscL conformational dynamics:

These complementary approaches have collectively revealed that MscL undergoes dramatic conformational changes during gating, with significant movements of the transmembrane helices and expansion of the pore region .

How can molecular dynamics simulations enhance understanding of MscL gating?

Molecular dynamics (MD) simulations have been crucial for understanding MscL gating mechanisms by:

• Simulating MscL behavior in lipid bilayers under tension to stabilize expanded states that are difficult to capture experimentally .

• Revealing pore hydration dynamics during channel opening, showing progressive hydration of the initially hydrophobic pore constriction .

• Investigating protein-lipid interactions, particularly how lipids interact with the N-terminus during channel expansion, supporting the 'dragging' model of lipid involvement in gating .

• Testing mechanisms of chemical activation, such as how sulfhydryl modification of cysteine residues in the pore affects channel opening .

• Predicting binding sites for potential modulators and agonists, guiding experimental design for pharmacological studies .

For optimal results, simulations should include explicit representation of membrane lipids, sufficient simulation time to capture conformational transitions (typically microseconds), and appropriate application of membrane tension to mimic physiological activation conditions .

What genetic engineering approaches are most effective for studying MscL function?

Several genetic engineering strategies have proven valuable for MscL research:

• Site-directed mutagenesis: Introducing specific mutations to identify functional residues. Key approaches include:

  • Creating gain-of-function (GOF) mutations that increase channel activity, particularly in the first TM helix (TM1)

  • Creating loss-of-function (LOF) mutations that increase activation barriers or abolish gating

  • Random mutagenesis combined with high-throughput screening to identify novel functional mutations

• Cysteine substitution with chemical modification:

  • Introducing cysteine residues at specific positions (e.g., G22C in the pore)

  • Attaching sulfhydryl-reactive modulators to create pH- or light-sensitive channels

  • Using spin labels like MTSSL for EPR studies while simultaneously modulating channel function

• Fluorescent tagging:

  • Creating MscL-sfGFP fusion proteins for quantification of expression levels

  • Using chromosomal integration to ensure physiologically relevant expression levels

  • Verifying functionality through electrophysiology and osmotic shock survival assays

These approaches have collectively revealed crucial insights about channel stoichiometry, gating mechanisms, and structure-function relationships .

How can MscL be utilized for controlled delivery of bioactive molecules into cells?

MscL can serve as a controllable delivery system for introducing membrane-impermeable molecules into cells through several approaches:

• Functional expression of MscL in mammalian cells creates pores that allow rapid controlled uptake of membrane-impermeable molecules when activated .

• The large pore size (>25 Å) permits passage of large organic ions and small proteins that would otherwise be excluded by the cell membrane .

• Channel activation can be controlled using established methods of charge-induced activation rather than relying on mechanical stimulation .

• The system has been successfully used to introduce the cell-impermeable bicyclic peptide phalloidin, a specific marker for actin filaments, into cells .

For optimal delivery efficiency, researchers should:

• Engineer MscL variants with modified gating properties tailored to specific cargo sizes

• Optimize expression levels to balance delivery efficiency with cell viability

• Consider using pH- or light-sensitive MscL variants for precise temporal control of molecule delivery

What role does MscL play in bacterial osmoregulation and stress response?

MscL serves as a crucial emergency release valve during hypoosmotic shock in bacteria:

• When bacteria experience sudden decreases in external osmolarity, water influx causes increased turgor pressure and membrane tension .

• MscL opens in response to this increased membrane tension, allowing rapid efflux of cytoplasmic osmolytes, including ions and small metabolites .

• This rapid release prevents lethal membrane damage that would otherwise occur from excessive pressure .

• MscL typically activates only under extreme stress conditions, after smaller channels like MscS have already responded, acting as a final safeguard against membrane rupture .

• The osmoprotective function of MscL can be experimentally demonstrated through osmotic downshock survival assays, where cells lacking functional MscL show decreased viability under severe hypoosmotic conditions .

• The channel closes once membrane tension decreases, preventing excessive loss of cellular contents .

Research has demonstrated that this mechanosensitive response depends solely on tension in the lipid bilayer, as MscL retains its mechanosensitivity when reconstituted into artificial lipid systems .

How do lipid-protein interactions affect MscL gating?

Lipid-protein interactions play crucial roles in MscL gating through several mechanisms:

• Lipid acyl chain interactions with transmembrane pockets: The TM pocket of MscL is occupied by lipid acyl chains that help determine the conformational state of the channel. When these interactions are disrupted by mutations (e.g., L89W) or chemical modifications, the closed state is destabilized, leading to subconducting states .

• Lipid bilayer thickness effects: Changes in membrane thickness affect the energetics of MscL gating, with thinner membranes generally facilitating channel opening by reducing the energetic cost of hydrophobic mismatch during pore expansion .

• Membrane curvature influences: Lipids that induce membrane curvature (like lysophospholipids) can lower the energy barrier for MscL opening by creating local membrane deformations that favor the open state .

• Specific binding sites at subunit interfaces: Several MscL agonists bind at the interface between the S1 and TM1 region of one subunit with the TM2 of another at the membrane-cytoplasmic interface, suggesting this region is critical for transducing lipid-mediated signals .

• S1 domain interactions: The amphipathic S1 helix interacts strongly with lipids during channel expansion, contributing to the "dragging" model of gating where lipid movements help drive conformational changes in the protein .

These interactions provide multiple avenues for modulating MscL function through lipid composition changes or targeted mutations at lipid-interaction sites .

What are the main challenges in expressing and purifying functional recombinant MscL?

Several challenges must be addressed when working with recombinant MscL:

• Protein aggregation: MscL, being a membrane protein, has hydrophobic regions that can cause aggregation during purification.

  • Solution: Use appropriate detergents that maintain protein stability without disrupting structure. Optimize glycerol concentration (typically 50%) in storage buffers .

• Maintaining native conformation: Loss of function during purification is common.

  • Solution: Validate function through patch-clamp analysis of reconstituted channels. Confirm characteristic conductance and pressure sensitivity post-purification .

• Variable expression levels: Inconsistent expression can complicate experimental reproducibility.

  • Solution: Consider chromosomal integration of mscL genes rather than plasmid-based expression for more consistent expression levels .

• Background interference: Native mechanosensitive channels can interfere with characterization.

  • Solution: Express MscL in strains with disrupted chromosomal mechanosensitive channel genes .

• Reconstitution challenges: Improper reconstitution can yield non-functional channels.

  • Solution: Optimize lipid composition to match native bacterial membrane characteristics. Use established protocols for liposome preparation with appropriate protein-to-lipid ratios .

How can researchers quantify MscL expression levels in experimental systems?

Accurate quantification of MscL expression is essential for interpreting functional data, with several complementary methods available:

• Fluorescence microscopy with tagged MscL:

  • Create MscL-sfGFP fusion proteins that retain functionality

  • Use a "standard candle" strain with known MscL copy number for calibration

  • Calculate fluorescence units per MscL channel to determine protein levels in experimental samples

  • This approach provides single-cell resolution of MscL expression

• Quantitative immunoblotting:

  • Use specific anti-MscL polyclonal antibodies

  • Prepare calibration curves with purified recombinant MscL

  • Analyze band intensities through densitometry

  • This approach works well for population-level quantification

• Ribosome binding site (RBS) modifications:

  • Engineer strains with modified ribosome binding sites to achieve different expression levels

  • Create a series of strains with varying MscL abundance

  • Select appropriate strains for specific experimental requirements

For most accurate results, researchers should integrate multiple quantification approaches and include appropriate controls for autofluorescence, non-specific antibody binding, and protein degradation .

What controls are essential when studying MscL modulation by pharmacological agents?

When investigating pharmacological modulation of MscL activity, several crucial controls should be included:

• Lipid bilayer integrity checks:

  • Monitor membrane capacitance throughout experiments to ensure drug compounds don't disrupt membrane integrity

  • Test effects of compounds on protein-free liposomes to distinguish specific channel modulation from non-specific membrane effects

• Concentration-response relationships:

  • Establish complete dose-response curves for potential modulators

  • Determine EC50/IC50 values to characterize potency

  • Example: Ramizol showed concentration-dependent effects on MscL gating threshold in patch-clamp experiments

• Specificity controls:

  • Test compounds on mutant channels with altered binding sites

  • Examine effects on other mechanosensitive channels (e.g., MscS) to determine selectivity

  • Consider potential off-target effects, as seen with ramizol which likely has multiple cellular targets

• Vehicle controls:

  • Test effects of solvent vehicles used for drug delivery

  • Ensure observed effects aren't due to vehicle-induced changes in membrane properties

• Positive controls:

  • Include known MscL modulators (e.g., gadolinium as an inhibitor)

  • Compare new compounds to established modulators to benchmark efficacy

These controls help distinguish genuine pharmacological modulation from artifacts and provide robust characterization of modulator properties and mechanisms .