Recombinant Escherichia coli O139:H28 NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
nuoA; EcE24377A_2581; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Escherichia coli O139:H28 (strain E24377A / ETEC)
Target Names
nuoA
Target Protein Sequence
MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSA RLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRI GALDWTPARSRRERMNPETNSIANRQR
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is the presumed immediate electron acceptor. This redox reaction is coupled to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thus conserving redox energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the characteristics of E. coli O139:H28 strain used for recombinant nuoA expression?

E. coli O139:H28 (strain E24377A) is a specific serotype with particular virulence characteristics. This strain is categorized as an enterotoxigenic E. coli (ETEC), identified by its O (somatic) and H (flagellar) surface antigens . Key characteristics include:

FeatureDescription
SerotypeO139:H28
CategoryETEC (Enterotoxigenic E. coli)
Virulence FactorsProduces coli surface-associated antigen 1 (CS1), heat-stable and heat-labile enterotoxins, CS3
Gene RegulationCS1 production is controlled by a plasmid with regulatory sequence homologous to cfaD/rns
Reference StrainE24377A

The strain contains plasmids that encode various virulence factors, including heat-stable and heat-labile enterotoxins. It also possesses the nuoA gene, which encodes the NADH-quinone oxidoreductase subunit A protein . When used for recombinant protein expression, this strain's genomic nuoA can be cloned into expression vectors with appropriate tags (such as His-tag) for purification and characterization purposes .

What experimental design approaches are recommended for studying nuoA function in energy conservation?

For studying nuoA function in energy conservation, several experimental designs can be employed:

Single Gene Knockout and Complementation Approach

  • Generate a nuoA knockout strain using homologous recombination techniques

  • Compare the phenotypes of wild-type and knockout strains

  • Perform complementation studies by reintroducing the wild-type or mutated nuoA gene

This approach follows the genetic analysis method used by researchers studying the nuo locus, where an isogenic collection of nuo mutants was created to study the physiological, biochemical, and molecular consequences of lacking specific Nuo subunits .

Site-Directed Mutagenesis of Conserved Residues

For analyzing specific amino acid residues in nuoA:

Experimental StepMethodology
1. Identification of target residuesSequence alignment of nuoA across species to identify conserved residues
2. MutagenesisClone nuoA gene into a vector, perform site-directed mutagenesis
3. Strain constructionReplace chromosomal nuoA with mutated versions using techniques like that employed for NuoD studies
4. Functional assaysMeasure NADH dehydrogenase activity, proton translocation, and growth phenotypes
5. Data analysisCompare mutant activities to wild type, calculate percentage of activity retained

Similar to studies on NuoD, where mutants (e.g., Y273F and H224R) were analyzed for their effects on enzyme activity and inhibitor sensitivity , nuoA could be subjected to comparable analyses focusing on conserved charged residues potentially involved in proton translocation.

Two-Group Experimental Design with Controls

When studying phenotypic effects:

  • Divide subjects (cells) into balanced treatment groups based on baseline measurements

  • Use appropriate control groups to account for variables other than the one being tested

  • Apply statistical analysis using two-sample t-tests between experimental and control groups at the second measurement point

This design is especially important when studying the effects of environmental conditions on nuoA function or expression.

How can researchers address expression challenges when producing recombinant nuoA protein?

Recombinant nuoA expression presents challenges due to its membrane protein nature. Here are methodological approaches to address these challenges:

Optimization of Expression Systems

  • Vector Selection: Use vectors with tunable promoters (e.g., pET series) that allow control of expression levels.

  • E. coli Strain Selection: Consider specialized strains such as:

    • BL21(DE3): Robust strain reaching higher ODs than K-strains

    • C41(DE3) or C43(DE3): Specifically developed for membrane protein expression

Expression Condition Optimization

For membrane proteins like nuoA, consider the following parameters:

ParameterOptimization StrategyRationale
TemperatureLower to 16-25°CReduces inclusion body formation
Inducer concentrationUse 0.1-0.5 mM IPTGControls expression rate
Growth mediaTry terrific broth or auto-induction mediaProvides better buffering capacity
Induction timeInduce at mid-log phase (OD600 0.6-0.8)Balances biomass and protein production
AdditivesInclude glycerol (5-10%) in mediaStabilizes membrane proteins

Membrane Protein Extraction and Purification

Since nuoA is a membrane protein (147 aa) with multiple transmembrane domains:

  • Use specialized detergents (DDM, LDAO, or Triton X-100) for solubilization

  • Apply gentle lysis methods to preserve protein structure

  • Consider purification under native conditions using immobilized metal affinity chromatography (IMAC) for His-tagged constructs

Based on the successfully purified recombinant nuoA described in the search results, the protein can be obtained as a lyophilized powder after purification, with greater than 90% purity as determined by SDS-PAGE .

What approaches can be used to analyze the interaction between nuoA and other subunits of the NADH:quinone oxidoreductase complex?

To analyze interactions between nuoA and other subunits of the NADH:quinone oxidoreductase complex, researchers can employ several sophisticated approaches:

Cross-linking Studies

Similar to studies mentioned for the Paracoccus denitrificans NDH-1 subunit:

  • Apply chemical cross-linkers to intact NDH-1 complex

  • Identify cross-linked products by immunochemical analysis

  • Confirm direct interactions between nuoA and other subunits

This technique can reveal which subunits directly contact nuoA in the assembled complex.

Co-immunoprecipitation and Pull-down Assays

For tagged recombinant nuoA:

  • Express His-tagged nuoA in E. coli

  • Perform pull-down experiments using Ni-NTA resin

  • Identify co-precipitating subunits by western blotting or mass spectrometry

Homology Modeling and Structural Analysis

As was done for E. coli NuoCD, NuoH, and NuoA:

  • Construct 3D models based on crystallographic data from homologous proteins (e.g., T. thermophilus enzyme)

  • Predict interaction interfaces and critical residues

  • Validate through site-directed mutagenesis of predicted interface residues

The 3D structural model can identify conserved regions in nuoA that might interact with other subunits. For instance, the modeling approach used for NuoD revealed interactions with other subunits in the complex that could be tested experimentally .

What are the optimal storage and handling conditions for recombinant nuoA protein?

Based on the information provided for recombinant E. coli O139:H28 nuoA protein , the following storage and handling conditions are recommended:

Storage Conditions

The protein should be stored as follows:

Storage FormConditionDuration
Lyophilized powder-20°C/-80°CLong-term storage
Reconstituted protein4°CUp to one week
Aliquoted with glycerol-20°C/-80°CLong-term storage

Reconstitution Protocol

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended default)

  • Aliquot for long-term storage at -20°C/-80°C

Handling Recommendations

  • Avoid repeated freeze-thaw cycles as they can damage protein structure and activity

  • Use Tris/PBS-based buffer with 6% trehalose at pH 8.0 as a storage buffer

  • For working solutions, maintain aliquots at 4°C for up to one week

  • When designing experiments, account for potential degradation during storage and handling

These recommendations are based on standard protocols for membrane proteins and the specific information provided for the recombinant nuoA protein.

How can researchers validate the functional integrity of recombinant nuoA protein?

To validate the functional integrity of recombinant nuoA protein, researchers should employ multiple complementary approaches:

Enzyme Activity Assays

Based on methodologies used for related studies:

  • NADH-K3Fe(CN)6 Reductase Activity: Measures the activity of the NADH dehydrogenase module

    • Mix purified complex or membrane preparations containing nuoA with NADH and K3Fe(CN)6

    • Monitor the reduction of K3Fe(CN)6 spectrophotometrically at 420 nm

  • NADH-Q Reductase Activity: Assesses quinone reduction capability

    • Use deamino-NADH as substrate (specific for Complex I)

    • Measure the rate of quinone reduction spectrophotometrically

  • Proton Translocation Assays: Evaluate the proton pumping function

    • Use inverted membrane vesicles containing the recombinant protein

    • Monitor pH changes with pH-sensitive dyes or electrodes upon NADH addition

Immunochemical Analysis

  • Perform western blot analysis using antibodies specific to nuoA

  • Verify the correct molecular weight (expected size plus any tags)

  • Assess complex assembly by blue native PAGE followed by immunodetection

In Vivo Complementation

To validate biological function:

  • Introduce recombinant nuoA into a nuoA knockout strain

  • Assess restoration of growth phenotypes, especially under conditions requiring respiratory chain function

  • Compare respiratory activities between complemented strains and wild type

The approach similar to that used for site-specific nuoA mutants can be employed, where immunochemical analysis and NADH dehydrogenase activity-staining were used to assess whether mutations affected the assembly of the complex .

What statistical approaches are recommended for analyzing experimental data involving nuoA mutants?

When analyzing experimental data involving nuoA mutants, researchers should employ appropriate statistical methods based on the experimental design. Here are recommended approaches:

For Comparing Two Treatment Groups

Following the methodology described in result :

  • Two-Sample t-test: When comparing independent control and experimental groups

    • Appropriate for comparing NADH-Q reductase activity between wild-type and mutant strains

    • Example application: Analyzing whether nuoA mutations affect enzyme activity compared to wild-type

  • Paired t-test: When each sample is measured under both conditions

    • Useful for before-and-after measurements on the same preparation

    • Provides greater statistical power by eliminating individual variation

    • Example: Measuring activity of the same preparation under different inhibitor concentrations

Statistical TestWhen to UseAdvantages
Two-Sample t-testIndependent control vs experimental groupsSimpler design, allows separate optimization of groups
Paired t-testSame samples under different conditionsHigher statistical power, requires fewer samples

For Multiple Comparisons

When comparing multiple mutants or conditions:

  • ANOVA: For comparing more than two groups

    • Use one-way ANOVA when comparing multiple mutations at a single site

    • Use two-way ANOVA when examining interactions between mutations and environmental conditions

  • Post-hoc Tests: After significant ANOVA results

    • Tukey's HSD test for all pairwise comparisons

    • Dunnett's test when comparing multiple groups to a single control

Experimental Design Considerations

For robust statistical analysis:

  • Ensure adequate sample sizes based on power analysis

  • Create balanced treatment groups based on baseline measurements

  • Include appropriate controls for all variables except the one being tested

  • Randomize the order of treatments when possible to avoid time-dependent bias

For example, when studying site-specific nuoA mutants similar to the NuoD studies, researchers reported activity as a percentage relative to wild-type, with mutants showing varied levels of activity retention (30-90%) . Such data should be analyzed with appropriate statistical tests to determine if the differences are significant.

How can nuoA research be integrated into broader studies of bacterial respiratory complexes?

Integrating nuoA research into broader studies of bacterial respiratory complexes requires systematic approaches that connect individual subunit analysis to whole-complex function and cellular energetics:

Comparative Genomics Approach

  • Compare nuoA sequences and structures across diverse bacterial species

  • Identify conserved features that indicate functional importance

  • Correlate nuoA variations with respiratory chain differences between species

This approach can reveal evolutionary patterns and functional constraints on nuoA, similar to how the nuo locus has been analyzed as a model for understanding the minimal form of type I NADH dehydrogenase in different organisms .

Systems Biology Integration

To position nuoA in the broader context of cellular respiration:

Level of IntegrationMethodological ApproachExpected Outcome
Protein ComplexBlue native PAGE, cryo-EM, cross-linkingPhysical positioning of nuoA within Complex I
Metabolic NetworkFlux balance analysis, metabolic control analysisnuoA contribution to respiratory flux
TranscriptomicRNA-seq under varying conditionsCo-regulation patterns with other respiratory genes
InteractomicProtein-protein interaction networksIdentification of non-Complex I interaction partners

Functional Integration Studies

  • In vivo studies: Measure respiratory parameters in strains with nuoA mutations

  • In vitro reconstitution: Assemble Complex I from purified components including recombinant nuoA

  • Electron transfer measurements: Determine how nuoA affects electron flow from NADH to quinone

These approaches can help position nuoA research within the broader framework of bacterial bioenergetics, similar to how studies on NuoD contributed to understanding quinone binding and electron transfer in Complex I .

What experimental designs are recommended for studying the role of nuoA in bacterial pathogenicity?

Given that nuoA is found in pathogenic strains like E. coli O139:H28, which is associated with enterotoxigenic properties , the following experimental designs can help elucidate its role in pathogenicity:

Virulence Association Studies

  • Comparative analysis: Compare nuoA sequence/expression between pathogenic and non-pathogenic strains

  • Genetic knockout studies: Generate nuoA deletion mutants in pathogenic strains and assess virulence

  • Complementation assays: Restore nuoA function and confirm recovery of phenotypes

Host-Pathogen Interaction Models

For E. coli O139:H28 specifically:

Model SystemApplicationMeasurements
Cell culture modelsIntestinal epithelial cell linesAdhesion, invasion, cytotoxicity
Organ cultureHuman intestinal tissue explantsTissue damage, inflammatory response
Animal modelsMouse intestinal colonizationColonization efficiency, disease symptoms

Mechanistic Studies

  • Metabolic contribution: Assess how nuoA-dependent energy conservation affects survival in host environments

  • Stress response: Determine if nuoA mutations alter bacterial resistance to host-generated stresses (oxidative, pH, etc.)

  • Co-regulation analysis: Investigate if nuoA is co-regulated with virulence factors under host conditions

These approaches could reveal whether nuoA and the respiratory chain play direct or supportive roles in the pathogenicity of strains like E. coli O139:H28, which produces enterotoxins and colonization factors . The experimental designs should follow similar principles to those used for studying other virulence factors, with appropriate controls and statistical analyses as described in results and .

How can researchers design experiments to study the regulation of nuoA expression in response to environmental conditions?

To study how nuoA expression responds to environmental conditions, researchers can implement several experimental designs:

Transcriptional Regulation Studies

Based on approaches used for studying nuo locus regulation :

  • Reporter Gene Assays:

    • Fuse the nuoA promoter region to a reporter gene (e.g., lacZ, GFP)

    • Expose bacteria to different environmental conditions

    • Measure reporter activity to quantify promoter activation

  • Transcription Factor Identification:

    • Perform DNA affinity chromatography using the nuoA promoter region

    • Identify bound proteins by mass spectrometry

    • Confirm interactions through electrophoretic mobility shift assays (EMSA)

Expression Analysis Under Variable Conditions

Environmental VariableExperimental ApproachMethod of Analysis
Oxygen availabilityGrowth under aerobic, microaerobic, and anaerobic conditionsqRT-PCR, Western blot
Carbon sourceGrowth with different carbon sources (glucose, glycerol, acetate)RNA-seq, proteomics
Growth phaseSampling at different points in the growth curveNorthern blot, qRT-PCR
Stress conditionsExposure to oxidative stress, pH stress, nutrient limitationMicroarray, qRT-PCR

Advanced Regulatory Network Analysis

  • ChIP-seq: Identify genome-wide binding sites for transcription factors that regulate nuoA

  • RNA-seq: Assess global transcriptional responses to conditions that affect nuoA expression

  • Network Reconstruction: Integrate data to map regulatory interactions controlling nuoA

As demonstrated in the genetic analysis of the nuo locus, studies on NuoG showed that this peripheral subunit plays a role in the regulation of nuo expression and/or the assembly of complex I . Similar regulatory relationships might exist for nuoA, which could be revealed through these experimental approaches.

When designing these experiments, researchers should implement the controlled experimental design principles described in result , ensuring proper controls and statistical analysis to isolate the effect of each environmental variable on nuoA expression.

What are the key challenges in achieving high-yield expression of functional recombinant nuoA protein?

Expressing functional recombinant nuoA presents several challenges due to its nature as a membrane protein. Here are the key challenges and methodological solutions:

Membrane Protein Solubility Issues

ChallengeTechnical SolutionMethodological Approach
HydrophobicityUse specialized expression systemsExpress with fusion partners like MBP or SUMO
Protein misfoldingOptimize growth temperatureLower to 16-25°C to slow folding process
Toxic effects on hostUse tightly regulated expressionEmploy systems with minimal leaky expression

Proper Membrane Insertion

  • Co-expression with chaperones: Include molecular chaperones to assist proper folding

  • Membrane-targeting signals: Ensure native signal sequences are present or replaced with functional alternatives

  • Host strain selection: Choose strains optimized for membrane protein expression, such as C41(DE3) or C43(DE3)

Protein Yield Optimization

For E. coli O139:H28 nuoA specifically:

  • Codon optimization: Adjust codons to match E. coli expression preferences

  • Media optimization: Use enriched media with proper osmolarity for membrane proteins

  • Induction conditions: Test various inducer concentrations and induction times

  • Scale-up considerations: Maintain proper aeration and mixing in larger cultures

The successfully expressed recombinant E. coli O139:H28 nuoA protein described in the search results was produced as a His-tagged fusion protein in E. coli, suggesting that this approach can yield functional protein . Based on this success, researchers should consider similar expression strategies, with modifications to address any specific challenges encountered.

How can researchers troubleshoot assembly issues when studying nuoA's integration into Complex I?

When studying nuoA's integration into Complex I, researchers may encounter assembly issues that require systematic troubleshooting:

Diagnostic Approaches for Assembly Problems

  • Blue Native PAGE Analysis:

    • Extract membrane complexes under non-denaturing conditions

    • Separate on BN-PAGE gels

    • Detect Complex I and subcomplexes using activity staining or immunoblotting

    • Identify whether nuoA mutations cause accumulation of specific subcomplexes

  • Subunit Ratio Analysis:

    • Quantify stoichiometry of Complex I subunits by western blotting

    • Compare wild-type to nuoA mutants

    • Determine if specific subunits are under- or over-represented

Rescue Strategies for Assembly Defects

Assembly IssueRescue ApproachMethodological Implementation
Unstable subcomplexesCrosslinking analysisApply mild crosslinkers to stabilize interactions
Subunit mismatchCo-expression strategiesSimultaneously express multiple subunits from polycistronic constructs
Improper membrane insertionMembrane composition modificationSupplement with phospholipids that promote proper folding
Incorrect disulfide formationRedox environment optimizationManipulate glutathione ratios in expression system

Interaction Mapping Techniques

To identify specific assembly issues:

  • Site-specific mutagenesis: Target conserved residues in nuoA that might be involved in subunit interactions

  • Direct interaction testing: Use techniques like bacterial two-hybrid systems to confirm binary interactions

  • Cryo-EM analysis: Determine structural differences between wild-type and mutant complexes

These approaches are based on similar studies of complex I assembly, where researchers have investigated how mutations in various subunits affect the assembly and activity of the entire complex . For example, studies on NuoD mutants used immunochemical and NADH dehydrogenase activity-staining analyses to assess whether mutations affected the assembly of peripheral subunits .

What methodological approaches can overcome challenges in studying nuoA's role in proton translocation?

Studying nuoA's role in proton translocation presents significant technical challenges due to the complexity of the process and the integrated nature of the proton pumping machinery. Here are methodological approaches to overcome these challenges:

Direct Proton Translocation Measurement

  • Inverted Membrane Vesicles (IMVs):

    • Prepare IMVs from strains expressing wild-type or mutant nuoA

    • Monitor pH changes using pH-sensitive fluorescent dyes (e.g., ACMA)

    • Initiate proton pumping with NADH and measure fluorescence quenching

    • Compare proton pumping efficiency between wild-type and mutant strains

  • Reconstituted Proteoliposomes:

    • Purify Complex I containing wild-type or mutant nuoA

    • Reconstitute into liposomes with controlled lipid composition

    • Measure proton translocation using pH-sensitive dyes or electrodes

    • Determine H+/e- stoichiometry by comparing proton translocation to electron transfer rates

Site-Directed Mutagenesis Strategies

Targeting amino acids potentially involved in proton translocation:

Residue TypeMutagenesis StrategyExpected Outcome
Conserved charged residuesReplace with neutral amino acidsDisruption of proton wire
Conserved protonatable residuesConservative vs. non-conservative changesIdentify essential protonation sites
Membrane-facing residuesAlter hydrophobicityIdentify proton entry/exit paths

This approach is similar to that used for NuoA, where site-specific mutants (K46A, E51A, D79N, D79A, E81Q, E81A) were constructed to investigate the roles of conserved charged residues .

Advanced Biophysical Techniques

  • Hydrogen/Deuterium Exchange Mass Spectrometry:

    • Expose Complex I to D2O buffer under different conditions

    • Analyze deuterium incorporation patterns by mass spectrometry

    • Identify regions with differential solvent accessibility during catalysis

  • Real-time Spectroelectrochemical Methods:

    • Apply potential steps to drive electron transfer

    • Monitor proton movements spectroscopically

    • Correlate electron transfer and proton translocation kinetically

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.