Recombinant Escherichia coli O139:H28 NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Escherichia coli O139:H28 NADH-Quinone Oxidoreductase Subunit K (nuoK)

The recombinant NADH-quinone oxidoreductase subunit K (nuoK) from E. coli O139:H28 is a His-tagged protein expressed in E. coli. It belongs to the NDH-1 complex, a proton-translocating NADH:ubiquinone oxidoreductase critical for bacterial respiration. The subunit is encoded by the nuoK gene (UniProt ID: A7ZP93), with a full-length sequence spanning 100 amino acids (aa) .

PropertyDetails
Gene NamenuoK
UniProt IDA7ZP93
Protein LengthFull-length (1–100 aa)
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
FormLyophilized powder
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
Amino Acid SequenceMIPLQHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQV MYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG

Primary Sequence and Functional Domains

The nuoK subunit contains a hydrophobic transmembrane domain, consistent with its role in the membrane arm of NDH-1. Key conserved residues include:

  • Glu-36 and Glu-72: Critical for proton translocation and electron transfer coupling .

  • Arginine residues: Positioned on cytosolic loops, potentially involved in stabilizing the proton channel .

Protein Stability and Handling

  • Storage: Aliquots stored at -20°C/-80°C; avoid repeated freeze-thaw cycles .

  • Reconstitution: Suggested in sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .

Electron Transfer and Proton Translocation

NDH-1 couples NADH oxidation to quinone reduction, translocating protons across the membrane. NuoK, as part of the membrane domain, interacts with subunits like NuoL and NuoM to form the proton channel . Mutagenesis studies reveal:

  • Glu-36 mutation: Nearly abolishes proton translocation and electron transfer, highlighting its role in coupling .

  • Glu-72 mutation: Reduces enzymatic activity, suggesting involvement in proton pumping .

Key Mutational Studies

MutationEffect on ActivityProposed Role
Glu-36 → AlaNull activity; loss of proton gradient generation .Critical for proton translocation.
Glu-72 → AlaReduced electron transfer and proton pumping .Facilitates proton channel dynamics.
Arg-58/Arg-59 → AlaSevere impairment in coupled activities .Stabilizes cytosolic loop interactions.

Use in Research

  • Structural Studies: Investigating proton translocation mechanisms .

  • Biochemical Assays: ELISA kits for detecting nuoK in E. coli O139:H28 strains .

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we understand that specific requirements may arise. If you have a preference, please indicate it during the order placement and we will accommodate your request to the best of our ability.
Lead Time
Delivery timelines may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributor.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is required, please inform us in advance for necessary arrangements and associated fees.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For proper reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Dissolve the protein in deionized sterile water to a final concentration ranging from 0.1-1.0 mg/mL. To enhance long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquotting the solution for storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid forms is 6 months when stored at -20°C/-80°C. For lyophilized forms, the shelf life extends to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquotting is essential. Avoid repeated freeze-thaw cycles for optimal product integrity.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us and we will prioritize its inclusion in the development process.
Synonyms
nuoK; EcE24377A_2572; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Escherichia coli O139:H28 (strain E24377A / ETEC)
Target Names
nuoK
Target Protein Sequence
MIPLQHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQV MYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG
Uniprot No.

Target Background

Function
NDH-1 serves as a crucial electron shuttle in the respiratory chain. It facilitates the transfer of electrons from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones. In this particular species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. This process couples the redox reaction with proton translocation across the cytoplasmic membrane, moving four hydrogen ions for every two electrons transferred. This coupling effectively conserves the redox energy within a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the NADH-quinone oxidoreductase subunit K (nuoK) in Escherichia coli?

NuoK is the Escherichia coli homologue of the mitochondrial ND4L subunit, which is the smallest mitochondrial DNA-encoded subunit of the proton-translocating NADH-quinone oxidoreductase (complex I). It is one of the seven hydrophobic subunits located in the membrane domain of the bacterial NADH-quinone oxidoreductase (NDH-1) complex. The protein bears three transmembrane segments (TM1-3) and plays a crucial role in the energy-transducing mechanism of the enzyme complex .

What is the functional significance of nuoK in bacterial metabolism?

The nuoK subunit is integral to the function of the bacterial NDH-1, which catalyzes electron transfer from NADH to quinone coupled with proton pumping across the cytoplasmic membrane. This process is fundamental to energy production in bacteria. The subunit contributes to the coupling mechanism that ensures electron transfer is efficiently linked to proton translocation, thereby helping to generate the electrochemical gradient necessary for ATP synthesis. Mutations in key residues of nuoK can severely impair this coupled activity, highlighting its importance in bacterial energy metabolism .

How does the structure of nuoK relate to its function?

The nuoK subunit contains three transmembrane segments that anchor it within the membrane domain of NDH-1. Two highly conserved glutamic acid residues, positioned in adjacent transmembrane helices (Glu-36 in TM2 and Glu-72 in TM3), are particularly important for energy-coupled activity. The positioning of these acidic residues within the membrane is critical, as they likely participate in proton translocation pathways. Additionally, arginine residues located in a short cytoplasmic loop between TM1 and TM2 (loop-1) are essential for proper function. This structural arrangement allows nuoK to contribute to the complex's ability to couple electron transfer with proton pumping .

What are the recommended methods for performing site-specific mutations in the nuoK gene?

For site-specific mutagenesis of the nuoK gene, homologous recombination techniques have proven effective. The process typically involves:

  • Designing primers containing the desired mutation flanked by 20-25 nucleotides matching the target sequence

  • Amplifying the mutated fragment using PCR

  • Incorporating the mutated fragment into a suitable vector

  • Transforming the construct into E. coli cells

  • Selecting for recombinants using appropriate markers

  • Confirming mutations through DNA sequencing

When planning mutation studies, researchers should prioritize highly conserved residues, such as Glu-36 and Glu-72, as these are most likely to produce observable functional effects. The experimental design should include appropriate controls, such as wild-type strains and multiple independent mutant clones to ensure reproducibility .

How can researchers effectively measure the functional impact of nuoK mutations?

To assess the functional impact of nuoK mutations, researchers should employ multiple complementary approaches:

Measurement TechniqueParameters AssessedApplication
Blue-native gel electrophoresisComplex assemblyVerifies that mutated NDH-1 is properly assembled
ImmunostainingSubunit presenceConfirms expression and integration of mutated nuoK
Coupled electron transfer assaysEnzyme activityMeasures NADH:quinone oxidoreductase activity
Membrane potential measurementsProton translocationAssesses generation of electrochemical gradient
Growth rate analysisPhysiological impactEvaluates cellular fitness effects of mutations

When interpreting results, researchers should distinguish between effects on assembly versus function. For instance, mutations that preserve complex assembly but eliminate activity (as observed with Glu-36 mutations) suggest specific roles in the coupling mechanism rather than structural stability .

How do researchers determine the optimal sample size for nuoK mutation studies?

Determining the appropriate sample size for nuoK mutation studies requires careful power analysis. The sample size calculation should account for:

  • The anticipated effect size based on previous studies or pilot data

  • The desired statistical power (typically 80-90%)

  • The significance level (usually α = 0.05)

  • The inherent variability in enzyme activity measurements

For nuoK studies, researchers should consider that sample size increases with power, increases with decreasing detectable difference, increases proportionally to measurement variance, and must be larger for two-sided tests than one-sided tests. For example, when studying subtle mutations with expected moderate effects on enzyme activity, larger sample sizes will be required compared to mutations with dramatic functional impacts like those observed for Glu-36 .

The power analysis formula for a two-sample t-test is:

n=2(Zα/2+Zβ)2σ2Δ2n = \frac{2(Z_{\alpha/2} + Z_{\beta})^2\sigma^2}{\Delta^2}

Where n is the sample size per group, Z values correspond to desired significance and power levels, σ² is the variance, and Δ is the minimum detectable difference .

What approaches are recommended when experimental data contradicts hypothesized roles of nuoK residues?

When experimental data contradicts hypothesized roles of nuoK residues, researchers should follow these methodological steps:

  • Thoroughly examine the data: Review all raw data to identify any anomalies or outliers that might influence results. Conduct statistical analyses to determine if the contradiction is statistically significant .

  • Verify experimental conditions: Ensure that all experimental parameters, including growth conditions, protein expression levels, and assay conditions, were appropriately controlled. Small variations in these factors can significantly impact enzyme activity measurements .

  • Consider alternative hypotheses: Develop new hypotheses that could explain the unexpected results. For example, if a mutation predicted to disrupt activity instead maintains function, consider whether compensatory mechanisms might be at play or if the residue serves a different role than initially predicted .

  • Expand mutation analysis: Perform additional mutations at neighboring positions or double/triple mutations to better understand the functional context of the residue in question. For instance, studies have shown that shifting Glu-36 along TM2 to positions 32, 38, 39, and 40 retained significant activity, suggesting flexibility in the precise positioning of this functional residue .

  • Combine with structural information: Integrate the unexpected findings with available structural data to refine understanding of the protein's functional mechanism. This approach has been valuable in interpreting the roles of transmembrane glutamate residues in nuoK .

How can researchers effectively design multifactorial experiments to study nuoK interactions with other NDH-1 subunits?

Designing multifactorial experiments to study nuoK interactions requires careful planning:

  • Identify key factors: Determine the primary factors to investigate, such as specific residues in nuoK and potential interacting residues in other subunits. Based on current understanding, interactions between nuoK and other membrane domain subunits like nuoH, nuoJ, and nuoN are particularly relevant .

  • Use factorial design: Rather than studying one factor at a time, implement a factorial design that varies multiple factors simultaneously. This approach allows for the detection of interaction effects between different mutations or conditions that might not be apparent in single-factor studies .

  • Consider within-subject comparisons: When possible, design experiments to compare treatments within the same biological preparation to reduce variability. For membrane proteins like nuoK, this might involve comparing different mutants expressed in the same bacterial strain background .

  • Implement randomization: Randomize the order of experiments and sample processing to minimize the impact of uncontrolled variables and reduce systematic bias .

  • Use blocking strategies: Group experimental units into blocks based on known sources of variation (such as different batches of bacterial cultures) to improve precision in estimating treatment effects .

What techniques are most effective for analyzing the membrane topology of nuoK?

Several complementary techniques can be employed to analyze the membrane topology of nuoK:

  • Biochemical approaches:

    • Cysteine scanning mutagenesis combined with accessibility studies using membrane-impermeable sulfhydryl reagents

    • Protease protection assays to identify exposed regions

    • Chemical cross-linking to identify proximity relationships with other subunits

  • Biophysical methods:

    • Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling

    • Fluorescence resonance energy transfer (FRET) to measure distances between labeled sites

    • Hydrogen/deuterium exchange mass spectrometry to identify exposed regions

  • Computational approaches:

    • Transmembrane helix prediction algorithms

    • Molecular dynamics simulations of nuoK within a lipid bilayer

    • Homology modeling based on related structures

These methods have collectively contributed to our understanding that nuoK contains three transmembrane segments with conserved glutamic acid residues (Glu-36 and Glu-72) positioned in adjacent transmembrane helices, which are crucial for coupling electron transfer with proton translocation .

How can researchers interpret the functional significance of conserved residues in nuoK across different bacterial species?

Interpreting the functional significance of conserved residues requires a systematic approach:

  • Multiple sequence alignment: Align nuoK sequences from diverse bacterial species to identify highly conserved residues. Perfect or near-perfect conservation across evolutionary distant species strongly suggests functional importance.

  • Conservation pattern analysis: Examine the pattern of conservation in relation to predicted structural features. For example, the conservation of Glu-36 in TM2 and Glu-72 in TM3 across bacterial species suggests their critical role in proton translocation .

  • Correlation analysis: Look for co-evolving residues, which may indicate functional or structural relationships between different parts of the protein.

  • Functional domain mapping: Map conserved residues onto known functional domains or motifs. In nuoK, conserved residues cluster in the transmembrane regions and cytoplasmic loops, correlating with their roles in proton pumping and interactions with other subunits .

  • Experimental validation: Test the functional significance of conserved residues through site-directed mutagenesis. Studies have shown that mutation of the highly conserved Glu-36 to Ala leads to almost complete loss of coupled activity, confirming its essential role .

Conservation LevelExample ResiduesObserved Functional Impact of Mutation
Nearly perfectGlu-36 (TM2)Almost null activities of coupled electron transfer
Highly conservedGlu-72 (TM3)Significant diminution of coupled activities
Conserved clusterArg-25, Arg-26 (loop-1)Severe impairment when simultaneously mutated

What statistical approaches are recommended for analyzing enzyme activity data from nuoK mutant studies?

For analyzing enzyme activity data from nuoK mutant studies, researchers should employ these statistical approaches:

  • Descriptive statistics: Calculate means, standard deviations, and coefficients of variation for all experimental groups to characterize the central tendency and dispersion of the data.

  • Normality testing: Verify the distribution of your data using tests like Shapiro-Wilk or Kolmogorov-Smirnov to determine whether parametric or non-parametric tests are appropriate.

  • Comparison testing:

    • For comparing a single mutant to wild-type: paired t-test (parametric) or Wilcoxon signed-rank test (non-parametric)

    • For comparing multiple mutants: one-way ANOVA with post-hoc tests (parametric) or Kruskal-Wallis with post-hoc tests (non-parametric)

    • For factorial designs examining multiple factors: multi-way ANOVA with interaction terms

  • Regression analysis: When examining relationships between continuous variables (e.g., correlation between enzyme activity and proton translocation), use regression models to quantify these relationships.

  • Effect size calculation: Report not only p-values but also effect sizes (e.g., Cohen's d) to quantify the magnitude of differences between experimental groups .

When reporting results, include full statistical information, including test statistics, degrees of freedom, p-values, and confidence intervals to ensure reproducibility and transparency .

How should researchers approach unexpected data that contradicts established models of nuoK function?

When faced with data that contradicts established models of nuoK function, researchers should follow this methodological framework:

  • Validate the unexpected findings: First, confirm that the unexpected results are reproducible and not due to technical errors or artifacts. Repeat key experiments with additional controls and consider using alternative methodologies to verify the findings .

  • Review assumptions: Critically evaluate the assumptions underlying the original model. For example, if a nuoK mutant retains activity despite mutation of a supposedly essential residue, question whether the residue truly serves the hypothesized function or if compensatory mechanisms exist .

  • Consider alternative explanations: Develop multiple alternative hypotheses that could explain the contradictory data and design experiments to test these new hypotheses. For instance, when relocating the conserved Glu-36 residue in TM2 to positions 32, 38, 39, and 40 unexpectedly retained activity, researchers considered the three-dimensional arrangement of the transmembrane helix and found these positions were located in the same helical face .

  • Integrate with broader knowledge: Place the contradictory findings in the context of the broader literature on respiratory complexes and membrane proteins to identify similar cases that might inform interpretation .

  • Refine the model: Use the contradictory data to refine and improve the existing model rather than discarding it entirely. Scientific progress often occurs through the refinement of existing models in response to new data .

  • Transparently report contradictions: When publishing, clearly acknowledge the contradictions and discuss their implications for the field, as this transparency advances scientific understanding .

What are promising approaches for investigating the proton translocation mechanism involving nuoK?

Several promising approaches for investigating the proton translocation mechanism involving nuoK include:

  • Time-resolved spectroscopy: Apply ultrafast spectroscopic techniques to track the kinetics of proton movement through the enzyme complex in real-time, potentially revealing the sequence of proton transfer events.

  • pH-sensitive probes: Develop and utilize pH-sensitive fluorescent probes that can be positioned at specific sites within or near nuoK to monitor local pH changes during enzyme turnover.

  • Computational simulations: Implement advanced molecular dynamics simulations incorporating quantum mechanical calculations to model proton transfer pathways through nuoK and neighboring subunits.

  • Cryo-EM structural studies: Pursue high-resolution cryo-electron microscopy structures of the NDH-1 complex in different functional states to capture conformational changes associated with proton translocation.

  • Proton inventory techniques: Apply proton inventory methods using deuterium isotope effects to determine the number of protons involved in rate-limiting steps of the reaction.

  • Revertant analysis: Generate and characterize revertants of inactive nuoK mutants to identify compensatory mutations that restore function, potentially revealing functional interactions within the proton translocation pathway .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.