Recombinant Escherichia coli O139:H28 p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aaeA; EcE24377A_3724; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Escherichia coli O139:H28 (strain E24377A / ETEC)
Target Names
aaeA
Target Protein Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQ VNVHDNQLVKKGQILFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGS TAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTR DDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFR KMAHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the AaeA protein and what is its role in E. coli?

AaeA (formerly known as YhcQ) is a membrane fusion protein that functions as a subunit of the AaeAB efflux pump system in Escherichia coli. This pump specifically exports aromatic carboxylic acids, particularly p-hydroxybenzoic acid (pHBA), from the bacterial cell. The AaeA protein works in conjunction with AaeB (formerly YhcP), which belongs to the putative efflux protein family. Together, they form a functional efflux pump that helps E. coli maintain homeostasis by removing potentially toxic aromatic carboxylic acids .

The physiological role of the AaeAB system appears to be as a "metabolic relief valve" to alleviate toxic effects that might arise from imbalanced metabolism, particularly when there is an accumulation of aromatic carboxylic acids within the cell .

What is the genetic organization of the aae gene cluster?

The aae gene cluster consists of four genes: aaeR, aaeX, aaeA, and aaeB (formerly yhcS, yhcR, yhcQ, and yhcP, respectively). The aaeR gene is divergently transcribed from the aaeXAB operon and encodes a regulatory protein of the LysR family. The aaeX gene encodes a small protein without a clearly defined function, though its genomic association with aaeA and aaeB suggests it may have some role in the system. The aaeA and aaeB genes encode the two components of the efflux pump: the membrane fusion protein (AaeA) and the efflux protein (AaeB), respectively .

The expression of the aaeXAB operon is regulated by AaeR, which responds to the presence of aromatic carboxylic acids by upregulating transcription of the efflux pump genes .

How can the function of AaeA be verified experimentally?

Verifying the function of AaeA requires a multi-faceted approach:

  • Gene deletion studies: Creating aaeA knockout mutants and assessing their sensitivity to potential substrates. The hypersensitivity of aaeA (yhcQ) mutant strains to p-hydroxybenzoic acid (pHBA) provides direct evidence of the protein's role in efflux .

  • Complementation experiments: Reintroducing the aaeA gene into mutant strains should restore resistance to substrate compounds. Research has shown that expression of both aaeA and aaeB was necessary and sufficient to suppress pHBA hypersensitivity in aaeR mutant strains .

  • Expression analysis: Using quantitative PCR or reporter gene constructs to measure changes in aaeA expression in response to potential inducers. Several aromatic carboxylic acids have been shown to induce aaeXAB expression .

  • Substrate accumulation assays: Measuring the intracellular accumulation of labeled substrates in wild-type versus aaeA-deficient strains to directly assess efflux activity.

  • Protein interaction studies: Using pull-down assays or co-immunoprecipitation to confirm interaction between AaeA and AaeB, which is essential for forming a functional efflux pump .

What expression systems are optimal for producing recombinant AaeA protein?

The optimal expression system for recombinant AaeA production is E. coli, which provides several advantages for membrane protein expression:

  • Expression vector selection: For AaeA, vectors with moderate promoter strength (such as pET vectors with T7lac promoters) allow controlled expression that minimizes toxicity while maximizing protein yield .

  • Host strain considerations: BL21(DE3) and its derivatives are commonly used for membrane protein expression. For AaeA specifically, strains with reduced proteolytic activity (like BL21(DE3) pLysS) can improve protein stability and yield .

  • Expression conditions: Optimal expression typically involves:

    • Induction at lower temperature (16-25°C rather than 37°C)

    • Lower IPTG concentrations (0.1-0.5 mM)

    • Extended expression times (overnight rather than 3-4 hours)

    • Rich media with glucose supplementation to minimize basal expression

  • Fusion tags: For AaeA, N-terminal His-tags have been successfully employed. The recombinant AaeA protein described in the search results includes an N-terminal His-tag, which facilitates purification without compromising function .

What purification strategy should be employed for recombinant AaeA?

Purification of recombinant His-tagged AaeA protein can be accomplished using the following strategy:

  • Cell lysis: Mechanical disruption (sonication or French press) in a buffer containing Tris-HCl (pH 8.0), NaCl, and a mild detergent to solubilize the membrane protein.

  • Initial purification: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with an imidazole gradient for elution.

  • Secondary purification: Size exclusion chromatography to remove aggregates and achieve high purity.

  • Storage: The purified protein should be stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0. For long-term storage, adding glycerol to a final concentration of 50% and storing at -20°C or -80°C is recommended .

  • Quality control: Purity assessment via SDS-PAGE (should exceed 90%) and functional verification through substrate binding or transport assays .

How does the substrate specificity of the AaeAB efflux pump compare to other efflux systems in E. coli?

The AaeAB efflux pump demonstrates a narrow substrate specificity compared to other E. coli efflux systems:

Efflux SystemSubstrate RangePrimary SubstratesRegulation
AaeABNarrowAromatic carboxylic acids, particularly pHBARegulated by AaeR (LysR-type)
AcrAB-TolCBroadAntibiotics, detergents, dyes, bile saltsMultiple regulators including MarA, SoxS, and Rob
CusCFBANarrowCopper and silver ionsTwo-component system (CusRS)

Unlike the well-characterized AcrAB-TolC system, which has a broad substrate range including various antibiotics, detergents, and dyes, the AaeAB system is highly specific for a limited set of aromatic carboxylic acids. This specificity suggests a specialized role in managing particular metabolic intermediates rather than general xenobiotic defense .

The substrate specificity of AaeAB was demonstrated by testing hundreds of diverse compounds, of which only a few aromatic carboxylic acids were identified as substrates. This contrasts with the AcrAB-TolC system, which is upregulated in response to diverse compounds like salicylic acid, methylviologen, and bile salts .

What is the evolutionary significance of the AaeAB efflux system?

The evolutionary significance of the AaeAB efflux system likely relates to its specialized role in E. coli metabolism:

  • Metabolic adaptation: The system appears to have evolved as a "metabolic relief valve" rather than as a general defense against antibiotics or environmental toxins. This suggests adaptation to specific metabolic pathways involving aromatic compounds.

  • Regulatory integration: The tight regulation by AaeR and the specific induction by aromatic carboxylic acids indicate evolutionary fine-tuning to respond precisely to metabolic imbalances.

  • Structural conservation: The membrane fusion protein (AaeA) and efflux protein (AaeB) architecture is conserved across many bacterial efflux systems, suggesting an ancient origin with subsequent specialization.

  • Comparative genomics: Analysis of the aae gene cluster across different bacterial species could provide insights into its evolutionary history and the selection pressures that shaped its function .

The highly regulated nature of the AaeAB system, in contrast to the more broadly regulated AcrAB-TolC system, suggests evolutionary specialization to manage specific metabolic challenges rather than general environmental stresses .

What approaches can be used to study the structure-function relationship of AaeA?

Several sophisticated approaches can be employed to investigate the structure-function relationship of AaeA:

  • Cryo-electron microscopy: This technique can provide high-resolution structural information about AaeA, particularly in complex with AaeB and potentially AaeX, revealing the molecular architecture of the efflux pump.

  • Site-directed mutagenesis: Systematic mutation of conserved residues within AaeA can identify amino acids critical for:

    • Interaction with AaeB

    • Substrate recognition

    • Conformational changes during transport

  • Crosslinking studies: Chemical crosslinking followed by mass spectrometry can map protein-protein interaction interfaces between AaeA and AaeB, as well as potential interactions with AaeX.

  • Molecular dynamics simulations: In silico modeling of AaeA structure and dynamics can predict conformational changes during the transport cycle and guide experimental design.

  • Substrate docking simulations: Computational modeling of substrate binding can identify potential interaction sites and guide mutagenesis studies.

  • Chimeric protein construction: Creating fusion proteins between AaeA and homologous proteins from other efflux systems can help identify domains responsible for substrate specificity and partner protein interactions .

What are common challenges in expressing and purifying functional AaeA protein?

Researchers frequently encounter several challenges when working with AaeA:

  • Protein toxicity: Overexpression of membrane proteins like AaeA can be toxic to E. coli host cells, leading to poor growth and low yields. This can be mitigated by using tightly controlled expression systems, lower incubation temperatures (16-20°C), and optimized induction conditions.

  • Protein aggregation: Membrane proteins are prone to aggregation during expression and purification. To address this:

    • Use lower IPTG concentrations (0.1-0.3 mM)

    • Include stabilizing agents like glycerol (5-10%) in lysis and purification buffers

    • Optimize detergent selection for extraction and purification

  • Protein degradation: AaeA may be susceptible to proteolytic degradation. Using protease-deficient strains (like BL21(DE3) pLysS) and including protease inhibitors in all buffers can minimize degradation.

  • Maintaining native structure: Recombinant AaeA must maintain its native structure for functional studies. Gentle purification conditions and appropriate detergent selection are critical. Avoid repeated freeze-thaw cycles of purified protein .

  • Functional verification: Confirming that purified AaeA remains functional is challenging but essential. Activity assays, such as reconstitution with AaeB in liposomes for transport studies, should be developed and optimized.

How can the interaction between AaeA and AaeB be studied experimentally?

Investigating the AaeA-AaeB interaction requires specialized approaches for membrane protein complexes:

  • Co-expression and co-purification: Simultaneous expression of both proteins with different affinity tags, followed by tandem affinity purification, can isolate the intact complex.

  • Bacterial two-hybrid systems: Modified two-hybrid systems suitable for membrane proteins can detect interactions between AaeA and AaeB in vivo.

  • Surface plasmon resonance (SPR): This technique can measure binding kinetics between purified AaeA and AaeB components when properly reconstituted or solubilized.

  • Förster resonance energy transfer (FRET): Tagging AaeA and AaeB with appropriate fluorophores enables detection of their interaction in reconstituted systems or in vivo.

  • Crosslinking mass spectrometry: Chemical crosslinking followed by proteomic analysis can identify specific residues involved in the interaction.

  • Cryo-electron microscopy: This can provide structural information about the assembled AaeA-AaeB complex.

  • Functional complementation: Co-expression of AaeA and AaeB in mutant strains can demonstrate their functional interaction through restoration of efflux activity and resistance to substrate compounds .

What are promising research avenues for understanding the physiological role of the AaeAB efflux system?

Several research directions could significantly advance our understanding of the AaeAB system:

  • Metabolomics integration: Comprehensive metabolomic analysis comparing wild-type and aaeAB mutant strains under various conditions could identify endogenous substrates and metabolic pathways connected to the efflux system.

  • Stress response networks: Investigating how the AaeAB system integrates with broader stress response networks could reveal its role in bacterial adaptation to environmental challenges.

  • Regulation mechanisms: Detailed characterization of how AaeR senses aromatic carboxylic acids and regulates aaeXAB expression would provide insights into the system's activation.

  • Role of AaeX: The function of the small protein AaeX remains unknown. Studies specifically focused on AaeX could reveal whether it plays an accessory role in efflux activity or regulation.

  • Structural biology: High-resolution structures of the complete AaeAB complex would significantly advance our understanding of its transport mechanism.

  • Systems biology approach: Integrating transcriptomics, proteomics, and metabolomics data could position the AaeAB system within the broader context of E. coli metabolism .

How might the AaeAB efflux system be exploited for biotechnological applications?

The specialized nature of the AaeAB system presents several opportunities for biotechnological applications:

  • Bioremediation: Engineered strains with enhanced AaeAB expression could potentially be used for bioremediation of specific aromatic pollutants.

  • Metabolic engineering: The AaeAB system could be leveraged to alleviate toxicity in engineered metabolic pathways involving aromatic intermediates, potentially improving production of valuable compounds.

  • Biosensor development: The specific response of the aaeXAB promoter to aromatic carboxylic acids could be used to develop biosensors for environmental monitoring or metabolic pathway optimization.

  • Protein engineering: Structure-function studies of AaeA and AaeB could inform the design of novel efflux pumps with altered substrate specificities for synthetic biology applications.

  • Drug development: Understanding the structure and function of bacterial efflux pumps like AaeAB contributes to our knowledge of multidrug resistance mechanisms and may inform strategies to combat antibiotic resistance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.