Recombinant Escherichia coli O139:H28 Phosphoglycerol transferase I (mdoB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
mdoB; opgB; EcE24377A_4952; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-763
Protein Length
full length protein
Species
Escherichia coli O139:H28 (strain E24377A / ETEC)
Target Names
mdoB
Target Protein Sequence
MSELLSFALFLASVLIYAWKAGRNTWWFAATLTVLGLFVVLNITLFASDYFTGAGINDAV LYTLTNSLTGAGVSKYILPGIGIVLGLTAVFGALGWILRRRRHHPHHFGYSLLALLLALG SVDASPAFRQITELVKSQSRDGDPDFAAYYKEPSKTIPDPKLNLVYIYGESLERTYFDNE AFPDLTPELGALKNEGLDFSHTQQLPGTDYTIAGMVASQCGIPLFAPFEGNASASVSSFF PQNICLGDILKNSGYQNYFVQGANLRFAGKDVFLKSHGFDHLYGSEELKSVVADPHYRND WGFYDDTVLDEAWKKFEELSRSGQRFSLFTLTVDTHHPDGFISRTCNRKKYDFDGKPNQS FSAVSCSQENIAAFINKIKASPWFKDTVIVVSSDHLAMNNTAWKYLNKQDRNNLFFVIRG DKPQQETLAVKRNTMDNGATVLDILGGDNYLGLGRSSLSGQSMSEIFLNIKEKTLAWKPD IIRLWKFPKEMKEFTIDQQKNIIAFSGSHFRLPLLLRVSDKRVEPLPESEYSAPLRFQLA DFAPRDNFVWVDRCYKMAQLWAPELALSTDWCVSQGQLGGQQIVQHVDKTTWQGKTAFKD TVIDMARYKGNVDTLKIVDNDIRYKADSFIFNVAGAPEEVKQFSGISRPESWGRWSNAQL GDEVKIEYKHPLPKKFDLVITAKAYGNNASRPIPVRVGNEEQTLVLGNEVTTTTLHFDNP TDADTLVIVPPEPVSTNEGNILGHSPRKLGIGMVEIKVVEREG
Uniprot No.

Target Background

Function
Phosphoglycerol transferase I (mdoB) catalyzes the transfer of a phosphoglycerol residue from phosphatidylglycerol to the membrane-bound nascent glucan backbones.
Database Links
Protein Families
OpgB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Phosphoglycerol transferase I and where is it located within bacterial cells?

Phosphoglycerol transferase I is an enzyme located in the inner cytoplasmic membrane of Escherichia coli. This enzyme plays a critical role in the biosynthesis of membrane-derived oligosaccharides (MDOs) by transferring phosphoglycerol residues from phosphatidylglycerol to these oligosaccharides. The enzyme has its active site positioned on the outer aspect of the inner membrane, which allows it to catalyze transfers to substrates in the periplasmic space . This specific localization is crucial for its function, as it enables the enzyme to access both the phospholipid substrate within the membrane and the acceptor oligosaccharides.

How does the mdoB gene relate to Phosphoglycerol transferase I activity?

The mdoB gene encodes Phosphoglycerol transferase I in Escherichia coli. Genetic mapping has positioned this gene near minute 99 on the E. coli chromosome, closely linked to serB and less closely linked to thr, with the gene order being mdoB serB thr in the clockwise direction . Mutations in the mdoB gene result in strains that lack detectable Phosphoglycerol transferase I activity. These mutants cannot transfer phosphoglycerol residues to substrates in vivo and synthesize membrane-derived oligosaccharides that are completely devoid of phosphoglycerol residues . Genetic studies have provided strong support for the direct involvement of the mdoB gene product in MDO biosynthesis.

What is the functional difference between Phosphoglycerol transferase I and Phosphoglycerol transferase II?

These two enzymes play distinct roles in phosphoglycerol metabolism:

CharacteristicPhosphoglycerol transferase IPhosphoglycerol transferase II
Encoding genemdoBNot specified in sources
Cellular locationInner cytoplasmic membraneSoluble, periplasmic
Phosphoglycerol donorPhosphatidylglycerolNot phosphatidylglycerol
Primary functionInitial transfer of phosphoglycerol to MDOInterchange of phosphoglycerol residues among soluble MDO species
Effect of mdoB mutationActivity completely lostNot affected (0.31 vs 0.33 U/mg protein/h in wild-type vs mdoB mutant)

Strains with mdoB mutations maintain normal phosphoglycerol transferase II activity despite lacking phosphoglycerol transferase I activity. This confirms that phosphoglycerol transferase II is not involved in the primary transfer of phosphoglycerol residues from phosphatidylglycerol to MDO but rather in subsequent modifications .

What established methods exist for assaying Phosphoglycerol transferase I activity?

Phosphoglycerol transferase I activity can be measured through several established assays:

  • In vitro transfer assay: This method measures the transfer of phosphoglycerol residues from phosphatidylglycerol to membrane-derived oligosaccharides or to model substrates like arbutin (p-hydroxyphenyl-β-D-glucoside). The reaction products are phosphoglycerol diester derivatives and sn-1,2-diglyceride .

  • Model substrate assay using arbutin: Because the enzyme transfers phosphoglycerol residues to soluble MDO forms relatively poorly and only at high MDO concentrations, model substrates with β-glucoside structures and hydrophobic aromatic aglycones (particularly arbutin) have proven more effective for both in vivo and in vitro studies .

  • Hydrolase assay for Phosphoglycerol transferase II: This complementary assay uses MDO labeled with [2-³H]glycerol as substrate to distinguish between the activities of the two transferases .

When preparing membrane fractions for these assays, researchers typically suspend E. coli cells in a buffer containing 50 mM Tris hydrochloride, 5 mM MgCl₂, and 0.6 mM dithiothreitol at pH 7.8, followed by sonication and differential centrifugation to isolate the membrane fraction .

How can researchers generate and isolate mdoB mutants?

Researchers have successfully used several strategies to generate and isolate mdoB mutants:

  • TnIO insertion mutagenesis: Using phage λ440 vector as a delivery system for the transposon into E. coli strains, followed by selection on tetracycline-containing media .

  • Selection for arbutin resistance in dgk strains: Strains with mutations in diglyceride kinase (dgk) accumulate sn-1,2-diglyceride when grown in media containing arbutin, which inhibits their growth. A second mutation in mdoB provides arbutin resistance, making this a powerful selection method. This approach is so effective that spontaneous mdoB mutants can be isolated without prior mutagenesis .

  • P1 transduction: Once isolated, mdoB mutations can be transferred between strains using P1 phage transduction, which allows for genetic analysis and the construction of strains with specific combinations of mutations .

After isolation, confirmation of mdoB mutants involves testing for:

  • Loss of Phosphoglycerol transferase I activity in vitro

  • Inability to transfer phosphoglycerol to arbutin in vivo

  • Production of MDOs lacking phosphoglycerol residues

What analytical methods are used to characterize MDO composition in mdoB mutants?

Several analytical approaches are employed to characterize the composition of membrane-derived oligosaccharides in wild-type and mdoB mutant strains:

  • Isolation of MDOs: MDOs are typically purified by chromatographic methods before analysis.

  • Glucose content determination: The glucose content of purified MDOs is determined colorimetrically to quantify the total amount of oligosaccharide.

  • Phosphoglycerol content analysis: This involves treatment of MDO with hydrogen fluoride (HF) to liberate glycerol, which is then assayed quantitatively.

  • Comparative analysis: The table below shows the dramatic effect of mdoB mutations on the phosphoglycerol content of MDOs:

StrainPhosphoglycerol transferase I activity (nmol/h per mg of protein)mol of phosphoglycerol per mol of MDO
AB1133 mdoB+6.02.0
NFB114 mdoB1<0.050.06
PT227 mdoB::TnIO<0.090.05

This data clearly demonstrates that mdoB mutations result in the near-complete absence of phosphoglycerol in MDOs, with levels dropping from 2.0 mol per mol of MDO in wild-type to less than 0.1 mol per mol in mutant strains .

What is the chromosomal location of the mdoB gene and how was it mapped?

The mdoB gene in E. coli has been mapped near minute 99 on the chromosome through genetic analysis. Three-factor crosses via P1 transduction were used to establish the gene order as mdoB serB thr in the clockwise direction . The following table summarizes the key results from these mapping experiments:

Selected markerUnselected markerTotal number of each
thr+serB+ Tetr35
thr+serB+ Tets38
thr+serB28 Tetr1
thr+serB28 Tets26
Tetrthr+ serB+35
Tetrthr+ serB281
Tetrthr-25 serB+21
Tetrthr-25 serB2843

These mapping data were obtained using P1 lysate of strain PT214 (mdoB::TnIO thr+ serB+) to transduce strain PC0950 (mdoB+ thr-25 serB28 Tets) to thr+ or Tetr, followed by scoring of inheritance patterns for the unselected markers .

How do mutations in phosphoglycerol transferase I affect the biochemical characteristics of membrane-derived oligosaccharides?

Mutations in the mdoB gene dramatically alter the biochemical composition of membrane-derived oligosaccharides. Wild-type E. coli strains produce MDOs containing approximately 2.0 moles of phosphoglycerol per mole of MDO. In contrast, mdoB mutants synthesize MDOs that are essentially devoid of phosphoglycerol residues, containing less than 3% of the wild-type level .

This biochemical difference provides strong genetic evidence for the physiological function of phosphoglycerol transferase I in transferring phosphoglycerol residues from phosphatidylglycerol to MDO in living cells. Interestingly, the lack of phosphoglycerol substitution does not prevent the formation of the basic oligosaccharide structure, indicating that phosphoglycerol addition is a modification to pre-existing MDO molecules rather than an essential step in their biosynthesis .

What is the proposed model for the function of phosphoglycerol transferase I in the MDO biosynthetic pathway?

Based on the available research, the following model for MDO biosynthesis involving phosphoglycerol transferase I has been proposed:

  • MDO precursors are synthesized from UDP-glucose by enzymes associated with a membrane carrier.

  • Phosphoglycerol transferase I catalyzes the transfer of phosphoglycerol residues from phosphatidylglycerol to a carrier-bound form of MDO, producing a phosphoglycerol diester derivative of MDO and sn-1,2-diglyceride as a byproduct.

  • The active site of phosphoglycerol transferase I is positioned on the outer aspect of the inner membrane, allowing it to access both phosphatidylglycerol in the membrane and MDO molecules.

  • Phosphoglycerol transferase II, a soluble periplasmic enzyme, catalyzes the interchange of phosphoglycerol residues among soluble species of MDO but is not involved in the primary transfer from phosphatidylglycerol.

  • The MDO molecules can receive multiple phosphoglycerol substitutions, resulting in various forms (MDO-P-GRO, MDO-(P-GRO)₂, etc.).

This model is supported by both biochemical evidence from in vitro studies and genetic evidence from the analysis of mdoB mutants, which lack the ability to transfer phosphoglycerol residues to MDO despite having normal phosphoglycerol transferase II activity .

Why do model substrates like arbutin work more effectively than natural MDO substrates in phosphoglycerol transferase I assays?

Phosphoglycerol transferase I catalyzes the transfer of phosphoglycerol residues from phosphatidylglycerol to soluble forms of MDO only poorly and requires high concentrations of MDO to achieve measurable activity in vitro. This observation is consistent with the hypothesis that a carrier-bound form of MDO, rather than soluble MDO, is the true physiological substrate for the enzyme .

In contrast, model substrates with β-glucoside structures and hydrophobic, aromatic aglycones, particularly arbutin (p-hydroxyphenyl-β-D-glucoside), are effectively utilized by the enzyme. The hydrophobic nature of these model substrates may facilitate interaction with the membrane-bound enzyme in a manner that more closely mimics the interaction with carrier-bound MDO in vivo .

This differential substrate specificity has practical implications for experimental design:

  • Studies of enzyme activity in vitro typically use arbutin as a substrate

  • The arbutin resistance phenotype provides a powerful selection method for isolating mdoB mutants

  • The transfer of phosphoglycerol to arbutin in vivo serves as a convenient assay for phosphoglycerol transferase I activity in living cells

What experimental evidence supports the physiological role of phosphoglycerol transferase I in MDO modification?

  • Genetic evidence: Mutations in the mdoB gene result in the production of MDOs completely devoid of phosphoglycerol residues, despite normal phosphoglycerol transferase II activity .

  • Biochemical characterization: Purified phosphoglycerol transferase I catalyzes the in vitro transfer of phosphoglycerol from phosphatidylglycerol to MDO and to model substrates like arbutin .

  • Topological considerations: The active site of phosphoglycerol transferase I is positioned on the outer aspect of the inner membrane, allowing it to access both the phospholipid donor in the membrane and the MDO acceptor .

  • Substrate specificity: While the enzyme transfers phosphoglycerol to soluble MDO poorly in vitro, this is consistent with the hypothesis that carrier-bound MDO is the true physiological substrate .

  • Functional distinction from phosphoglycerol transferase II: Unlike phosphoglycerol transferase I, phosphoglycerol transferase II does not use phosphatidylglycerol as a donor and only catalyzes the interchange of phosphoglycerol residues among soluble MDO species .

This convergence of genetic and biochemical evidence provides a solid foundation for understanding the role of phosphoglycerol transferase I in the MDO biosynthetic pathway.

What are the key experimental considerations when working with recombinant forms of phosphoglycerol transferase I?

When working with recombinant forms of phosphoglycerol transferase I, researchers should consider several important factors:

  • Membrane association: As an integral membrane protein, phosphoglycerol transferase I requires appropriate membrane environments for proper folding and activity. Expression systems should maintain the native membrane topology with the active site oriented toward the periplasmic space .

  • Substrate availability: Assays for recombinant enzyme activity should include either appropriate model substrates like arbutin or physiological substrates like MDO at sufficient concentrations .

  • Activity measurement: Due to the specificity of the enzyme for carrier-bound forms of MDO, activity measurements may require model substrates or specialized assay conditions to accurately assess enzyme function .

  • Strain background considerations: When expressing recombinant phosphoglycerol transferase I, the endogenous mdoB status of the host strain should be considered. Expression in mdoB mutant backgrounds can facilitate the assessment of the recombinant enzyme without interference from native activity .

  • Phospholipid environment: The phosphatidylglycerol content of the expression host's membranes may influence the activity of the recombinant enzyme, as phosphatidylglycerol serves as the phosphoglycerol donor for the reaction .

These considerations highlight the complex interplay between enzyme structure, membrane environment, and substrate accessibility that researchers must navigate when working with recombinant forms of this membrane-associated enzyme.

What aspects of phosphoglycerol transferase I function remain to be elucidated?

Despite significant progress in understanding the basic function of phosphoglycerol transferase I, several important aspects remain to be fully elucidated:

  • Detailed structural characterization: The three-dimensional structure of phosphoglycerol transferase I has not been determined, limiting our understanding of its catalytic mechanism and membrane topology.

  • Carrier-bound MDO: The exact nature of the proposed carrier-bound form of MDO, which is hypothesized to be the true physiological substrate for phosphoglycerol transferase I, remains to be characterized .

  • Regulatory mechanisms: How the activity of phosphoglycerol transferase I is regulated in response to changing environmental conditions or growth phases is not well understood.

  • Physiological significance: While the biochemical function of phosphoglycerol transferase I in MDO modification is established, the broader physiological significance of this modification for bacterial membrane function and stress responses requires further investigation .

  • Serotype-specific variations: Potential differences in the structure or function of phosphoglycerol transferase I between different E. coli serotypes, including O139:H28, have not been systematically explored.

Addressing these knowledge gaps will require interdisciplinary approaches combining structural biology, membrane biochemistry, bacterial genetics, and physiological studies.

How might phosphoglycerol transferase I function contribute to bacterial membrane homeostasis and stress responses?

The modification of membrane-derived oligosaccharides by phosphoglycerol transferase I likely contributes to bacterial membrane homeostasis and stress responses in several ways:

  • Membrane permeability: Phosphoglycerol-modified MDOs may influence the permeability and physical properties of the bacterial cell envelope, affecting the movement of molecules across the periplasmic space.

  • Osmotic regulation: MDOs are known to play roles in osmotic regulation, and their phosphoglycerol modification may fine-tune this function by altering their charge distribution and interaction with water molecules.

  • Membrane lipid homeostasis: The transfer of phosphoglycerol from phosphatidylglycerol generates diglyceride as a byproduct, potentially influencing membrane lipid composition and turnover .

  • Periplasmic protein interactions: The negatively charged phosphoglycerol residues on MDOs may mediate interactions with periplasmic proteins or contribute to the ionic environment of the periplasm.

  • Cell envelope integrity: By modifying components of the cell envelope, phosphoglycerol transferase I may indirectly contribute to maintaining envelope integrity under various stress conditions.

Further research into these potential functions could provide valuable insights into the physiological significance of MDO modification by phosphoglycerol transferase I and may reveal new aspects of bacterial membrane biology.

What methodological advances could enhance the study of phosphoglycerol transferase I and MDO biosynthesis?

Several methodological advances could significantly enhance our understanding of phosphoglycerol transferase I and MDO biosynthesis:

  • Cryo-electron microscopy: Application of high-resolution cryo-EM techniques could provide structural insights into phosphoglycerol transferase I within its native membrane environment.

  • In situ labeling approaches: Development of chemical biology approaches for labeling and tracking MDO biosynthesis in living cells could provide dynamic information about the process.

  • Synthetic biology tools: Engineering minimal systems for MDO biosynthesis could help dissect the roles of individual components and their interactions.

  • Advanced genetic screens: CRISPR-based screens could identify additional factors involved in MDO biosynthesis and modification that may have been missed by traditional genetic approaches.

  • Improved analytical methods: Development of more sensitive and high-throughput methods for analyzing MDO composition and modification could facilitate broader studies of how these molecules respond to different conditions.

  • Single-molecule techniques: Application of single-molecule approaches to study the dynamics of enzyme-substrate interactions could provide mechanistic insights into phosphoglycerol transferase I function.

These methodological advances would complement existing approaches and potentially reveal new aspects of this complex biosynthetic pathway and its regulation in bacterial cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.