Recombinant Escherichia coli O139:H28 Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Description

Introduction

The Kdp system, a high-affinity ATP-driven K+ transport system in Escherichia coli, is essential for maintaining potassium homeostasis, particularly under conditions of potassium limitation . The Kdp system is composed of four subunits: KdpF, KdpA, KdpB, and KdpC . These subunits are encoded by the kdpFABC operon . KdpC plays a crucial role in the assembly and stabilization of the Kdp complex .

Function of KdpC

KdpC is a membrane-bound subunit of the Kdp complex, essential for its assembly and stability . It interacts strongly with the KdpA subunit, facilitating the assembly of the Kdp complex . KdpC may serve as a link between the energy-delivering subunit KdpB and the K+-transporting subunit KdpA .

Kdp Complex Assembly

KdpC is vital for the correct assembly of the Kdp complex . In mutants lacking KdpC, KdpA and KdpB do not co-purify, indicating that KdpC is necessary for their interaction .

Studies with kdpC Deletion Strains

Studies using kdpC deletion strains have shown that the C-terminal amino acids are important for its function . Complementation experiments have been performed using different kdpC constructs to understand the functional regions of the protein .

Kdp System Regulation

The expression of the kdpFABC operon is regulated by the KdpD/KdpE two-component system in response to changes in turgor pressure and potassium concentration . KdpD is a sensor histidine kinase that phosphorylates KdpE, a response regulator, which then activates the transcription of the kdpFABC operon .

Escherichia coli O139:H28

Escherichia coli O139:H28 is a serotype known to produce coli surface-associated antigen 1 (CS1) . Production of CS1 is controlled by a plasmid that also encodes heat-stable and heat-labile enterotoxins and CS3 . While KdpC is a general component of the potassium transport system in E. coli, its presence in the O139:H28 serotype highlights its importance in maintaining cellular function, even when other virulence factors are present .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
kdpC; EcE24377A_0722; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Escherichia coli O139:H28 (strain E24377A / ETEC)
Target Names
kdpC
Target Protein Sequence
MRGLRPALSTFIFLLLITGGVYPLLTTVLGQWWFPWQANGSLIREGDTVRGSALIGQNFT GNGYFQGRPSATAEMPYNPQASGGSNLAVSNPELDKQIAARVAALRAANPDASTNVPVEL VTASASGLDNNITPQAAAWQIPRVAKARNLSVEQLTQLIAKYSQQPLVKYIGQPVINIVE LNLALDKLDE
Uniprot No.

Target Background

Function

This protein is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. Specifically, this subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.

Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the functional role of KdpC in the KdpFABC complex?

KdpC functions as a catalytic chaperone within the KdpFABC complex, which mediates high-affinity potassium uptake in Bacteria and Archaea. While the KdpB subunit is classified as a type IA P-type ATPase responsible for ATP hydrolysis, and KdpA resembles a potassium channel involved in K+ transport, KdpC plays a critical role in nucleotide binding . The KdpFABC complex represents a unique chimera of ion pumps and ion channels, with KdpC providing a specialized nucleotide-binding mechanism not typically found in either P-type ATPases or ion channels .

How does KdpC interact with ATP during potassium transport?

KdpC contains a conserved glutamine residue that is crucial for high-affinity nucleotide binding to the KdpFABC complex. This glutamine residue forms double hydrogen bonds with the ATP nucleotide, similar to the LSGGQ signature motif found in ABC transporters . Additionally, KdpC interacts with the nucleotide-binding loop of KdpB in an ATP-dependent manner around the ATP-binding pocket. This interaction increases ATP-binding affinity through the formation of a transient KdpB/KdpC/ATP ternary complex, enhancing the efficiency of ATP utilization during potassium transport .

What expression systems are most effective for recombinant KdpC production?

For recombinant kdpC expression, T7-based expression vectors in combination with BL21-AI™ E. coli strain have proven effective. These systems allow regulated, high-level expression of the protein under the control of the T7 promoter . Gateway®-adapted destination vectors like pDEST™14 (for native protein), pDEST™15 or pDEST™17 (for N-terminal tagged proteins), or pDEST™24 (for C-terminal tagged proteins) can be used depending on your experimental requirements . The choice between these vectors should be based on whether native KdpC or a fusion protein with tags for detection and purification is needed.

What are the optimal induction conditions for maximizing KdpC expression?

For T7-based expression systems utilizing BL21-AI™ E. coli, L-arabinose induction is recommended for optimal expression of T7 RNA polymerase, which subsequently drives expression of your recombinant kdpC gene . A typical protocol involves:

  • Growing the culture to mid-log phase (OD600 of 0.4-0.6)

  • Adding L-arabinose to a final concentration of 0.1-0.2%

  • Continuing incubation for 2-4 hours at 37°C with shaking

Temperature, induction time, and L-arabinose concentration may require optimization based on the stability and folding characteristics of the KdpC protein when expressed in the E. coli O139:H28 background.

How does the tertiary structure of KdpC contribute to its catalytic chaperone function?

The tertiary structure of KdpC is specialized to facilitate its role as a catalytic chaperone. The presence of the conserved glutamine residue creates a nucleotide-binding pocket that shares features with ABC transporters rather than typical P-type ATPases . This structural adaptation allows KdpC to coordinate ATP binding through specific interactions with the ribose moiety hydroxyl groups. Mutation studies have demonstrated that alterations to this glutamine residue significantly reduce high-affinity nucleotide binding to the KdpFABC complex, highlighting its structural importance .

In the functional complex, KdpC's tertiary structure enables it to interact with the nucleotide-binding loop of KdpB in an ATP-dependent manner, forming the transient ternary complex that enhances ATP binding affinity . This structural arrangement represents an evolutionary adaptation that optimizes the energy efficiency of the potassium transport process.

What are the key steps in designing an experiment to study KdpC-KdpB interactions?

To study the interactions between KdpC and KdpB, a multi-faceted experimental approach is recommended:

Experimental ApproachMethodologyExpected Outcome
Recombinant ExpressionGateway® cloning with pDEST™ vectors expressing tagged versions of KdpC and KdpBPure protein for interaction studies
Co-immunoprecipitationAntibody pull-down of KdpC to identify KdpB interactionConfirmation of physical interaction
ATP Binding AssaysMeasuring ATP binding with purified proteins using techniques like fluorescence or isothermal titration calorimetryQuantification of binding affinity constants
Site-Directed MutagenesisMutation of the conserved glutamine residue in KdpCDetermination of critical residues for interaction
Structural AnalysisX-ray crystallography or cryo-EM of the KdpB/KdpC/ATP complexVisualization of binding interfaces

When designing these experiments, it is crucial to consider the native conformation of the proteins and their membrane association. Expression of KdpC alone versus within the complete KdpFABC complex may yield different results, as the quaternary structure may impact protein folding and function .

How should researchers approach comparative studies between wild-type and recombinant KdpC?

When comparing wild-type and recombinant KdpC, researchers should:

  • Ensure equivalent expression levels through careful quantification

  • Verify proper folding of recombinant protein through circular dichroism or limited proteolysis

  • Compare functional parameters such as:

    • ATP binding affinity

    • Interaction with KdpB

    • Impact on ATPase activity of the complex

    • Potassium transport efficiency

Control experiments should include parallel analyses of wild-type KdpFABC complex from the native organism and the recombinant complex expressed in the same system. This approach helps distinguish differences due to the expression system versus inherent properties of the recombinant protein .

What strategies can address poor solubility of recombinant KdpC?

KdpC, as part of a membrane-associated complex, may present solubility challenges during recombinant expression. Consider these strategies:

  • Expression optimization:

    • Reduce induction temperature to 16-25°C

    • Decrease L-arabinose concentration to 0.01-0.05%

    • Shorten induction time to minimize aggregation

  • Solubility enhancement approaches:

    • Co-express with chaperone proteins (GroEL/GroES)

    • Use fusion tags known to enhance solubility (MBP, SUMO)

    • Add solubilizing agents like mild detergents for membrane-associated domains

  • Alternative expression strategies:

    • Express KdpC as part of the complete KdpFABC complex

    • Consider cell-free expression systems

    • Explore periplasmic expression approaches if appropriate

Empirical testing of these strategies with small-scale expression trials is recommended before scaling up to larger preparations .

How should researchers interpret changes in ATP binding affinity in KdpC mutants?

When analyzing ATP binding data for KdpC mutants, consider these interpretive frameworks:

  • Direct vs. indirect effects: Determine whether mutations directly affect the ATP binding site or disrupt the interaction with KdpB that indirectly influences ATP binding.

  • Structural context: Interpret binding affinity changes in the context of the KdpC tertiary structure and its interaction with KdpB, particularly around the ATP-binding pocket.

  • Functional correlation: Correlate changes in ATP binding with:

    • ATP hydrolysis rates by the KdpFABC complex

    • Potassium transport efficiency

    • Formation of the KdpB/KdpC/ATP ternary complex

  • Quantitative analysis: Calculate binding constants (Kd) and compare with wild-type values to assess the magnitude of effect. Significant changes (>5-fold) typically indicate functionally important residues .

How does KdpC from E. coli O139:H28 compare to other E. coli strains?

While specific data comparing KdpC from E. coli O139:H28 to other strains is limited in the provided search results, researchers should conduct comparative analyses examining:

  • Sequence homology analysis to identify strain-specific variations in:

    • The conserved glutamine residue region

    • KdpB interaction domains

    • ATP-binding motifs

  • Functional comparisons measuring:

    • ATP binding affinity

    • ATP hydrolysis rates

    • Potassium transport kinetics

    • Protein-protein interaction strength with KdpB

  • Expression level differences between strains under:

    • Potassium limitation stress

    • Various osmotic conditions

    • Different growth phases

These comparative analyses help identify strain-specific adaptations that may correlate with pathogenicity, environmental adaptation, or metabolic efficiency.

What are the best approaches for studying the transient KdpB/KdpC/ATP ternary complex?

The transient nature of the KdpB/KdpC/ATP ternary complex presents unique research challenges. Recommended methodological approaches include:

  • Cross-linking strategies:

    • Use reversible chemical cross-linkers to stabilize the transient complex

    • Employ photo-reactive ATP analogs that can covalently attach to binding sites

  • Real-time biophysical techniques:

    • Surface plasmon resonance (SPR) to monitor association/dissociation kinetics

    • Förster resonance energy transfer (FRET) with fluorescently tagged components

    • Hydrogen-deuterium exchange mass spectrometry to identify interaction interfaces

  • Computational approaches:

    • Molecular dynamics simulations to model the transient complex formation

    • Docking studies to predict binding configurations

  • Structural biology techniques:

    • Cryo-electron microscopy to capture different states of the complex

    • Time-resolved X-ray crystallography with rapid mixing/freezing

These approaches can be combined to provide complementary data on the formation, stability, and functional significance of the ternary complex in potassium transport .

What are the most promising future research directions for KdpC studies?

Based on current understanding of KdpC function, several promising research directions emerge:

  • Systems biology approaches to understand KdpC regulation within the broader context of potassium homeostasis in bacteria.

  • Comparative genomics and evolutionary analysis of KdpC across bacterial phylogeny to understand adaptation of potassium transport mechanisms.

  • Structural biology studies focusing on the complete KdpFABC complex in different conformational states during the transport cycle.

  • Investigation of KdpC as a potential antimicrobial target, given its essential role in bacterial potassium homeostasis.

  • Exploration of biotechnological applications, such as engineered KdpC variants with modified ATP binding properties for enhanced potassium transport in industrial or agricultural applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.