Recombinant Escherichia coli O139:H28 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Biological Function and Mechanism

ArnE functions as a subunit of the undecaprenyl phosphate-L-Ara4N flippase complex, facilitating the translocation of lipid-linked L-Ara4N across the inner bacterial membrane . This modification of lipid A is essential for polymyxin resistance in Escherichia coli and Salmonella typhimurium. Key findings include:

  • Genetic Inactivation: Disruption of arnE in E. coli pmrA(c) strains abolishes polymyxin resistance and eliminates L-Ara4N attachment to lipid A, despite unchanged levels of undecaprenyl phosphate-α-L-Ara4N .

  • Membrane Transport: ArnE collaborates with ArnF to form a heterodimeric flippase, concentrating undecaprenyl phosphate-α-L-Ara4N on the periplasmic membrane surface .

Role in Antibiotic Resistance

  • Polymyxin Sensitivity: arnE mutants show 4–5-fold reduced labeling of periplasmic undecaprenyl phosphate-α-L-Ara4N, confirming its role in transport .

  • Flippase Mechanism: ArnE/ArnF enables "flipping" of lipid-linked L-Ara4N to the outer membrane leaflet, a prerequisite for ArnT-mediated lipid A modification .

Experimental Validation

ExperimentWild-TypearnE Mutant
Polymyxin Resistance (MIC)Resistant (≥8 µg/mL)Sensitive (≤1 µg/mL)
L-Ara4N on Lipid APresentAbsent
Undecaprenyl-P-L-Ara4N LevelsUnchangedUnchanged

Industrial and Research Applications

  • Antimicrobial Studies: Used to investigate lipid A modification pathways and develop polymyxin adjuvants .

  • Protein-Protein Interaction: Serves as a tool for studying flippase complex assembly .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare it accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, and additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
arnE; EcE24377A_2553; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Escherichia coli O139:H28 (strain E24377A / ETEC)
Target Names
arnE
Target Protein Sequence
MIWLTLVFASLLSVAGQLCQKQATCFVAINKRRKHIVLWLGLALACLGLAMVLWLLVLQN VPVGIAYPMLSLNFVWVTLAAVKLWHEPVSPRHWCGVAFIIGGIVILGSTV
Uniprot No.

Target Background

Function
This protein facilitates the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane.
Database Links
Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE in Escherichia coli O139:H28?

The ArnE protein functions as a subunit of a flippase complex responsible for translocating 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner bacterial membrane . This protein belongs to the ArnE family and contains one EamA domain, which is characteristic of membrane transporters . The full recombinant protein from E. coli O139:H28 consists of 111 amino acids and is typically expressed with an N-terminal His tag for purification purposes . The protein plays a crucial role in lipopolysaccharide modification pathways that contribute to bacterial outer membrane biogenesis and potentially to antimicrobial resistance mechanisms.

How is ArnE involved in bacterial resistance mechanisms?

ArnE functions within the pathway for lipopolysaccharide modification, specifically in the translocation of 4-amino-4-deoxy-L-arabinose moieties to the outer membrane . This modification process is significant because it alters the charge characteristics of the bacterial outer membrane, potentially reducing the binding affinity of cationic antimicrobial peptides and certain antibiotics. The presence of this protein correlates with various antibiotic resistance mechanisms observed in E. coli strains. For instance, in clinical E. coli strains like those related to the O25:H4-ST131 clonal group, genomic and proteomic analyses have identified various resistance genes and stress response mechanisms that may work in concert with membrane modification systems . The expression of ArnE may be upregulated under antibiotic pressure or environmental stressors, contributing to the adaptive resistance profile of pathogenic E. coli strains.

What experimental approaches are most effective for studying ArnE expression and regulation?

For comprehensive analysis of ArnE expression and regulation, a multiomics approach is highly recommended, integrating genomic, transcriptomic, and proteomic methodologies:

  • Genomic Analysis: Whole-genome sequencing (WGS) using platforms such as Illumina MiSeq with paired-end reads (2 × 150 bp) provides the foundation for identifying the arnE gene and its genomic context . Sequence data should be processed using quality control tools like FastQC and Trimmomatic, followed by assembly with SPAdes and annotation with RAST .

  • Transcriptomic Analysis: RNA-Seq analysis is crucial for quantifying arnE expression levels under various conditions. This involves total RNA extraction using RNeasy Mini Kit with RNase-free DNase treatment, bacterial rRNA depletion, and library preparation using appropriate kits such as TruSeq Stranded mRNA LT Sample Prep Kit . The quality of RNA samples should be evaluated using tools like the 2100 Bioanalyzer before and after depletion.

  • Proteomic Analysis: Two-dimensional gel electrophoresis (2DE) of whole-cell and fractionated extracts followed by matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF/MS) provides detailed information about ArnE protein expression and interactions . This approach allows differentiation between membrane-associated and cytoplasmic proteins, crucial for understanding ArnE's membrane integration.

Analytical ApproachMethodologyKey Equipment/ReagentsData Analysis Tools
Genomic AnalysisWhole-genome sequencingIllumina MiSeq, Nextera XT DNA library preparation kitFastQC, Trimmomatic, SPAdes, RAST
Transcriptomic AnalysisRNA-SeqRNeasy Mini Kit, Ribo-Zero rRNA Removal Kit, TruSeq Stranded mRNA LT Sample Prep Kit2100 Bioanalyzer, RNA-Seq specific software
Proteomic Analysis2DE + MALDI-TOF/MSFractionation reagents, electrophoresis equipment, mass spectrometerProteomics databases, annotation tools

How can researchers address the challenges of purifying and handling recombinant ArnE protein?

Purifying and handling recombinant ArnE protein presents significant challenges due to its membrane-associated nature. Several methodological considerations include:

  • Expression Systems: E. coli expression systems are commonly used for recombinant ArnE production, with the protein typically fused to an N-terminal His tag to facilitate purification . Alternative expression systems in yeast, baculovirus, or mammalian cells may be considered for specific experimental requirements .

  • Purification Protocol: After expression, purification should achieve ≥85-90% purity as determined by SDS-PAGE . The protein is typically available in lyophilized form or liquid, depending on specific research requirements.

  • Storage and Reconstitution: Store the purified protein at -20°C or -80°C for extended periods . For reconstitution of lyophilized protein, brief centrifugation is recommended prior to opening to bring contents to the bottom of the vial . Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and consider adding 5-50% glycerol (with 50% as a standard final concentration) before aliquoting for long-term storage .

  • Stability Considerations: Repeated freeze-thaw cycles should be avoided to maintain protein integrity . For working aliquots, storage at 4°C for up to one week is recommended .

What techniques are most appropriate for investigating ArnE-ArnF interactions and complex formation?

Investigating the heterodimer formation between ArnE and ArnF requires specialized approaches for membrane protein complexes:

  • Co-immunoprecipitation: Using antibodies against tagged versions of either ArnE or ArnF to pull down the complex, followed by Western blotting to detect the interaction partner.

  • Förster Resonance Energy Transfer (FRET): Labeling ArnE and ArnF with appropriate fluorophores to detect proximity-based energy transfer, indicating complex formation in membrane environments.

  • Bacterial Two-Hybrid Systems: Modified for membrane proteins, these systems can detect interactions between ArnE and ArnF when fused to appropriate reporter fragments.

  • Crosslinking Studies: Chemical crosslinking followed by mass spectrometry analysis can identify specific residues involved in the ArnE-ArnF interface.

  • Native PAGE Analysis: Gentle extraction of membrane complexes followed by native gel electrophoresis can preserve and detect the intact ArnE-ArnF complex.

What are the recommended protocols for reconstituting and handling purified ArnE protein?

The following protocol is recommended for optimal handling of recombinant ArnE protein:

  • Reconstitution of Lyophilized Protein:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • For long-term storage, add glycerol to a final concentration of 5-50% (standard recommendation is 50%)

  • Storage Conditions:

    • Store unopened product at -20°C/-80°C

    • Store working aliquots at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles

  • Buffer Considerations:

    • The protein is typically supplied in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

    • This buffer composition helps maintain protein stability during storage

How can multiomics approaches enhance understanding of ArnE function in pathogenic E. coli strains?

Multiomics approaches provide comprehensive insights into ArnE function within the broader context of bacterial physiology, particularly in clinical isolates like those belonging to the hazardous intercontinental O25:H4-ST131 clone . A systematic approach includes:

  • Genome-Transcriptome-Proteome Integration: Combining WGS data with RNA-Seq and proteomic analyses allows researchers to correlate genetic variants, expression levels, and protein abundance of ArnE and related pathway components .

  • Functional Network Analysis: By integrating multiomics data, researchers can construct functional networks that place ArnE within broader cellular contexts such as stress responses, antibiotic resistance mechanisms, and membrane modification pathways .

  • Differential Expression Analysis: Comparing ArnE expression and protein levels under various conditions (e.g., antibiotic exposure, environmental stressors) using RNA-Seq and proteomic approaches reveals regulatory patterns and functional associations.

  • Subcellular Localization Profiling: Fractionation combined with proteomic analysis allows precise tracking of ArnE within membrane compartments, providing insights into its integration into the bacterial membrane and association with other components .

Omics LayerContribution to ArnE ResearchKey Findings in Clinical Strains
GenomicsIdentification of arnE gene variants and genomic contextConfirmation of serotype and phylogenetic relationships (e.g., O25:H4-ST131)
TranscriptomicsQuantification of arnE expression under various conditionsCorrelation with stress response and resistance gene expression
ProteomicsDetection of ArnE protein abundance and interactionsIdentification of co-expressed membrane proteins and functional partners
Integrative AnalysisPathway reconstruction and functional networksPositioning of ArnE within broader cellular processes

What quality control measures should be implemented when working with recombinant ArnE protein?

  • Purity Assessment: Verify protein purity using SDS-PAGE, with a target threshold of ≥85-90% . This ensures minimal contamination with host cell proteins.

  • Identity Confirmation: Confirm protein identity using mass spectrometry or Western blotting with specific antibodies against ArnE or the fusion tag.

  • Functional Verification: Where possible, develop functional assays to verify that the recombinant protein retains flippase activity or appropriate binding characteristics.

  • Endotoxin Testing: For sensitive applications, low endotoxin preparations should be requested and verified to prevent interference with downstream experiments .

  • Sterility Testing: When required for specific applications, sterile filtration can be requested to ensure the absence of microbial contamination .

  • Batch Consistency: Maintain detailed records of different protein batches and perform comparative analyses to ensure consistency between experiments.

How can researchers design experiments to investigate ArnE's role in lipopolysaccharide modifications and antibiotic resistance?

To effectively investigate ArnE's role in lipopolysaccharide modifications and antibiotic resistance, researchers should consider the following experimental design elements:

  • Gene Knockout and Complementation Studies: Generate arnE deletion mutants and complemented strains to assess the direct impact on lipopolysaccharide structure and antibiotic sensitivity profiles.

  • Expression Modulation: Use inducible promoters to control ArnE expression levels, allowing for dose-response studies correlating ArnE abundance with membrane modifications and resistance phenotypes.

  • Site-Directed Mutagenesis: Introduce specific mutations in functional domains to identify critical residues for ArnE function, particularly in the EamA domain and transmembrane regions.

  • Resistance Profile Characterization: Compare minimum inhibitory concentrations (MICs) of various antibiotics between wild-type, arnE-deficient, and overexpressing strains to establish correlations between ArnE function and specific resistance mechanisms.

  • Membrane Composition Analysis: Employ lipidomics approaches to characterize changes in lipopolysaccharide composition associated with ArnE expression, focusing on 4-amino-4-deoxy-L-arabinose incorporation.

  • In vitro Reconstitution: Develop proteoliposome systems incorporating purified ArnE and ArnF to reconstitute and directly measure flippase activity under controlled conditions.

What are the most promising future research directions for ArnE protein studies?

Several promising research directions will likely advance our understanding of ArnE function and applications:

  • Structural Studies: Determining the three-dimensional structure of the ArnE-ArnF complex would provide critical insights into the mechanism of lipid flipping and potential inhibitor design.

  • Inhibitor Development: As membrane modification systems contribute to antibiotic resistance, developing specific inhibitors of ArnE function could serve as adjuvants to restore antibiotic sensitivity in resistant strains.

  • Regulatory Networks: Further characterization of the regulatory networks controlling arnE expression would enhance our understanding of how bacteria modulate membrane modifications in response to environmental stimuli.

  • Cross-species Comparison: Comparative studies of ArnE homologs across diverse bacterial species could reveal evolutionary adaptations and species-specific functions of this protein family.

  • Point-of-Care Diagnostics: Exploring the potential of ArnE as a biomarker for specific resistance mechanisms could lead to the development of rapid diagnostic tools for clinical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.