Recombinant Escherichia coli O139:H28 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for custom preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
arnF; EcE24377A_2555; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; L-Ara4N-phosphoundecaprenol flippase subunit ArnF; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Escherichia coli O139:H28 (strain E24377A / ETEC)
Target Names
arnF
Target Protein Sequence
MGLIWGLFSVIIASVAQLSLGFAASHLPPMTHLWDFIAALLAFGLDARILLLGLLGYLLS VFCWYKTLHKLALSKAYALLSMSYVLVWIASMVLPGWEGTFSLKALLGVACIMSGLMLIF LPTTKQRY
Uniprot No.

Target Background

Function

This protein, a probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit (ArnF), facilitates the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) across the inner membrane of Escherichia coli O139:H28, moving it from the cytoplasm to the periplasm.

Database Links
Protein Families
ArnF family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of arnF and how does it compare to other flippase proteins?

ArnF belongs to a specialized class of membrane proteins that function as flippases, facilitating the translocation of lipid-linked substrates across cellular membranes. Similar to the RnlA toxin structure which consists of three distinct domains, arnF likely contains multiple functional domains including a membrane-spanning region and substrate binding domain. Based on structural studies of related proteins, arnF likely forms oligomeric structures in the membrane to create a hydrophilic passage for its substrate . Unlike the RnlA protein which forms dimers through Dmd-binding domains (DBDs), arnF's quaternary structure may involve different interaction interfaces suited to its flippase function.

What expression systems are most effective for producing recombinant arnF protein?

For membrane proteins like arnF, specialized expression systems are recommended. The BL21(DE3) strain derivatives C41(DE3) and C43(DE3) have been specifically engineered to withstand the expression of toxic or membrane proteins that might otherwise be lethal to the host cell . These Walker strains contain mutations in the lacUV5 promoter that reduce T7 RNA polymerase expression levels, allowing for more controlled and tolerable production of membrane proteins like arnF . For optimal results, use a low-copy number plasmid with a tunable promoter system rather than high-copy vectors that might lead to protein aggregation or host toxicity.

How does the arnF protein integrate into the bacterial membrane?

The integration of arnF into the bacterial membrane likely follows the SRP (Signal Recognition Particle) pathway, which is a co-translational translocation mechanism . This pathway recognizes hydrophobic signal sequences at the N-terminal end of the protein. Following interaction with the membrane receptor FtsY, the nascent protein-ribosome complex is transferred to the SecYEG translocase for membrane insertion . To study this process experimentally, fusion constructs with reporter tags placed at different positions can help determine the topology and membrane orientation of arnF.

What strategies can overcome toxicity issues when expressing recombinant arnF?

When expressing potentially toxic membrane proteins like arnF, researchers often encounter growth inhibition or cell death. Several strategies can mitigate these issues:

StrategyImplementationExpected Outcome
Tightly regulated expressionUse pET vectors with T7lac promoterMinimal basal expression before induction
Specialized host strainsC41(DE3) or C43(DE3)Better tolerance of membrane protein expression
Reduced culture temperatureShift to 18-25°C at inductionSlower protein synthesis, improved folding
Periplasmic secretionFusion with DsbA signal sequenceRouting via SRP pathway reduces cytoplasmic accumulation
Osmotic stabilizers0.5M sorbitol, 4% glycerol in mediumMembrane stabilization during protein insertion

If growth rate decline is observed before induction, this indicates basal expression toxicity which can be addressed by adding 0.5-1% glucose to the medium to further repress the lac-based promoter systems .

What purification approach yields the highest activity for arnF protein?

Purification of membrane proteins like arnF requires specialized approaches. Begin with membrane fraction isolation using ultracentrifugation following cell lysis. For solubilization, screen multiple detergents including n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), and digitonin at varying concentrations (0.5-2%). Following solubilization, immobilized metal affinity chromatography (IMAC) using a C-terminal His-tag is recommended, as N-terminal tags may interfere with membrane insertion. For higher purity, follow with size exclusion chromatography in buffer containing detergent at concentrations above its critical micelle concentration. Activity assays should be performed immediately after purification as membrane proteins often lose activity during storage.

How should experimental designs be optimized when studying arnF function?

When designing experiments to characterize arnF function, fractional factorial design approaches can maximize information while minimizing experimental runs. A two-level fractional factorial design (2k-p) allows for systematic investigation of multiple variables affecting arnF activity . For instance, a 26-1 experiment would require 32 experimental runs to investigate 6 factors that might affect arnF function, such as pH, temperature, substrate concentration, detergent type, lipid composition, and cofactor requirements. This approach is particularly valuable for optimizing reconstitution conditions for functional assays of membrane proteins like arnF.

How can CRISPR-Cas9 be utilized to study arnF in its native context?

CRISPR-Cas9 genome editing provides powerful tools for studying arnF in its native genetic context. To investigate the physiological role of arnF, researchers can create precise gene knockouts, introduce point mutations to disrupt specific domains, or add reporter tags to monitor protein localization and expression levels. When designing guide RNAs, select sequences with minimal off-target effects in the E. coli genome and construct repair templates with at least 500 bp homology arms flanking the modification site. After transformation, screening for successful edits can be performed using PCR followed by restriction digestion or sequencing. For complementation studies, the wild-type arnF can be expressed from an inducible plasmid to verify that phenotypic changes are directly attributable to arnF modification.

What techniques are most effective for analyzing arnF-substrate interactions?

Analyzing interactions between arnF and its substrate (4-amino-4-deoxy-L-arabinose-phosphoundecaprenol) requires specialized biophysical techniques. Surface plasmon resonance (SPR) can be employed using immobilized arnF in a lipid nanodisk environment to measure binding kinetics of the substrate. Alternatively, microscale thermophoresis (MST) allows for quantification of interactions in solution with minimal protein requirements. For structural insights, hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify regions of arnF that change conformation upon substrate binding. Crosslinking mass spectrometry using photoactivatable lipid analogs can map the substrate binding pocket within the protein structure. These approaches provide complementary information about how arnF recognizes and processes its substrate.

How does the activity of arnF affect antimicrobial resistance mechanisms?

The arnF protein is part of the arnBCADTEF operon involved in modifying lipopolysaccharide (LPS) with 4-amino-4-deoxy-L-arabinose, which reduces the negative charge of LPS and decreases binding of cationic antimicrobial peptides. Similar to how RnlA functions as part of a toxin-antitoxin system providing bacteriophage resistance in E. coli , arnF contributes to antimicrobial peptide resistance by facilitating the flipping of modified LPS components across the inner membrane. To measure this activity, researchers can use reporter strains with fluorescent markers linked to membrane permeability, or directly measure binding of fluorescently labeled antimicrobial peptides to cells with wild-type versus mutant arnF. Additionally, minimum inhibitory concentration (MIC) assays with various antimicrobial peptides can quantify how arnF mutations affect resistance profiles.

What methods can identify interaction partners of arnF in the bacterial membrane?

To identify protein interaction partners of arnF, several complementary approaches can be employed:

MethodAdvantagesLimitationsSample Preparation
Co-immunoprecipitationCaptures native interactionsRequires specific antibodiesGentle membrane solubilization
Bacterial two-hybridIn vivo detectionMay miss transient interactionsFusion constructs design critical
Proximity labeling (BioID)Captures spatial proximityCan identify non-direct interactorsExpression of biotin ligase fusion
Crosslinking mass spectrometryCaptures transient interactionsComplex data analysisOptimization of crosslinker concentration
Pull-down with tandem affinity purificationHigh specificityMay lose weak interactionsTwo-step purification process

When performing these experiments, it's crucial to include appropriate controls such as non-specific IgG for immunoprecipitation or unrelated membrane proteins for specificity verification. Data analysis should incorporate statistical methods to distinguish true interactions from background binding.

How can the interaction between arnF and other proteins in the arn operon be characterized?

The arnF protein likely functions in concert with other proteins encoded in the arnBCADTEF operon. To characterize these interactions, bacterial adenylate cyclase two-hybrid (BACTH) system can be employed, which is particularly suitable for membrane protein interactions. Construct fusion proteins linking arnF and potential partners (e.g., arnE) to complementary fragments of adenylate cyclase. Interaction reconstitutes cyclase activity, producing cAMP that activates reporter gene expression. For in vitro confirmation, prepare membrane protein complexes using tandem affinity purification with sequential tags on different operon components. Analyze the composition using blue native PAGE followed by western blotting or mass spectrometry. For structural studies of the complexes, cryo-electron microscopy of reconstituted proteoliposomes can provide valuable insights into the spatial arrangement of the protein components.

What in vitro assays can measure the flippase activity of purified arnF?

Measuring flippase activity requires specialized assays that can detect the translocation of lipid-linked substrates across membranes. One approach is to reconstitute purified arnF into proteoliposomes with fluorescently labeled substrate analogs. The accessibility of the fluorophore to membrane-impermeable quenchers or proteases on the outside of the vesicles indicates successful flipping. Alternatively, radioactively labeled substrates can be used with proteoliposomes containing arnF, followed by back-extraction or protease protection assays to quantify transported substrate. For higher throughput, develop a FRET-based assay using donor-labeled substrate and acceptor-labeled binding proteins on the opposite face of the membrane. Activity measurements should be performed across a range of temperatures (20-37°C) and pH values (6.0-8.0) to determine optimal conditions for arnF function.

How can site-directed mutagenesis be used to identify critical residues in arnF?

Site-directed mutagenesis is a powerful approach to identify functionally important residues in arnF. Based on sequence alignments with related flippases and structural predictions, target conserved charged residues in predicted transmembrane regions that might form the translocation pathway. Also focus on glycine-rich motifs that might provide conformational flexibility. After generating mutations, assess their impact using complementation assays in arnF knockout strains and in vitro activity measurements with purified proteins. For comprehensive analysis, create an alanine-scanning library across the entire protein sequence and measure the effect on both expression/stability (using western blotting) and function (using flippase assays). Results can be mapped onto structural models to identify functionally important domains and potential substrate interaction sites.

What are the challenges and solutions for determining the structure of arnF?

Membrane proteins like arnF present significant challenges for structural determination. X-ray crystallography requires stable, homogeneous protein samples that can form well-ordered crystals. For arnF, screening multiple detergents is essential, with mild detergents like DDM, LMNG, or GDN often being successful for membrane proteins. Lipidic cubic phase crystallization may be particularly suitable as it provides a membrane-like environment. Alternatively, cryo-electron microscopy (cryo-EM) has emerged as a powerful technique for membrane protein structure determination without crystallization. For successful cryo-EM studies, use amphipols or nanodiscs to maintain protein stability, and consider using antibody fragments to increase particle size and provide fiducial markers. Nuclear magnetic resonance (NMR) can provide complementary information about protein dynamics, particularly if selective isotope labeling is employed to focus on specific regions of interest.

How does the membrane environment affect arnF structure and function?

The lipid composition of the membrane significantly influences the structure and function of membrane proteins like arnF. To investigate these effects, reconstitute purified arnF into liposomes of varying composition, including different phospholipid headgroups (PE, PG, cardiolipin) and acyl chain lengths/saturation. Measure flippase activity in each condition using the assays described earlier. For structural insights, hydrogen-deuterium exchange mass spectrometry can identify regions of arnF that display altered solvent accessibility in different lipid environments. Molecular dynamics simulations can provide atomic-level details of how specific lipid interactions affect protein conformation. Additionally, fluorescence spectroscopy using strategically placed tryptophan residues or introduced fluorescent labels can monitor conformational changes in response to different membrane environments or substrate binding.

How can inhibitors of arnF be developed as potential antimicrobial agents?

Given arnF's role in antimicrobial peptide resistance, inhibitors could potentially sensitize bacteria to both endogenous host defense peptides and therapeutic antimicrobials. Structure-based drug design approaches can identify potential binding pockets once structural information is available. High-throughput screening of chemical libraries against purified arnF in reconstituted systems can identify lead compounds. Alternatively, fragment-based drug discovery using NMR or thermal shift assays can identify chemical scaffolds for further optimization. Evaluate candidate inhibitors using in vitro flippase assays, followed by determining their effect on antimicrobial peptide sensitivity in whole cells. For promising compounds, assess specificity by testing against human flippases and determine the mechanism of action using biochemical and biophysical assays. Resistance development studies and in vivo efficacy in infection models would be necessary for compounds advancing to preclinical development.

Can arnF be engineered for biotechnological applications?

The substrate translocation capability of arnF could potentially be engineered for biotechnological applications. Directed evolution approaches, including error-prone PCR and DNA shuffling, can be used to alter substrate specificity or enhance activity. To screen large libraries, develop high-throughput assays based on fluorescent substrate analogs or growth selection systems where cell survival depends on flippase activity. Successful variants could be employed for the production of modified glycolipids, serving as biosynthetic intermediates for complex carbohydrates or glycoconjugates. Another potential application is the development of reconstituted systems for in vitro synthesis of complex lipopolysaccharides, which could be valuable for vaccine development. The expertise gained from working with the C41(DE3) and C43(DE3) E. coli strains for toxic protein expression would be valuable in optimizing production systems for engineered arnF variants .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.