Recombinant Escherichia coli O139:H28 Probable intracellular septation protein A (yciB)

What is the basic structure and localization of yciB protein?

YciB is a polytopic inner membrane protein in Escherichia coli characterized by an N-terminal transmembrane domain and a domain of unknown function (DUF1043) . The full-length protein consists of 179 amino acids with the sequence MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVVFGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRMLGKELTLPQSVWSKLNLAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS . X-ray crystallography studies indicate that yciB forms a unique tetrameric α-helical coiled-coil structure, which is likely involved in connecting the Z-ring to septal peptidoglycan-synthesizing complexes . This structural arrangement supports its hypothesized role in cell division processes.

Why has yciB been renamed to ZapG in some studies?

Recent research has revealed that yciB plays a specific role in cell division by linking the Z-ring to septal peptidoglycan-synthesizing complexes . Based on these findings, researchers have proposed renaming the protein to ZapG (Z-ring-associated protein G) to better reflect its functional role in the divisome machinery . This nomenclature change represents the evolving understanding of this protein's function from a "probable intracellular septation protein" to a more specifically defined Z-ring associated protein with demonstrable roles in cell division processes.

What phenotypes are observed in yciB deletion mutants?

ΔyciB strains exhibit several distinct phenotypes related to cell division and envelope integrity. Key observations include:

• Impaired FtsZ-ring formation and assembly, with immunolabeling studies showing that Z-rings are not assembled properly or stably in ΔyciB cells

• Defective cell division resulting in filamentation of cells

• Hypersensitivity to antibiotics targeting cell wall synthesis, particularly β-lactams

• Aberrant or incomplete septum formation as revealed by peptidoglycan labeling studies

• Altered survival patterns in different growth phases when exposed to cell wall-targeting antibiotics

These phenotypes collectively suggest that yciB plays important roles in coordinating proper cell division and maintaining cell envelope integrity in E. coli.

What are the recommended methods for expressing and purifying recombinant yciB protein?

For successful expression and purification of recombinant yciB protein, E. coli expression systems have proven effective as indicated by commercially available products . The protein can be expressed with N-terminal His-tags to facilitate purification . For optimal results, the following methodology is recommended:

• Express the full-length protein (1-179 amino acids) in E. coli expression systems

• Use His-tag purification protocols followed by appropriate column chromatography methods

• Store the purified protein in Tris/PBS-based buffer containing 6% Trehalose at pH 8.0

• For long-term storage, add glycerol to a final concentration of 30-50% and store aliquots at -20°C to -80°C

• Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Avoid repeated freeze-thaw cycles as they may compromise protein integrity

This approach yields recombinant protein with greater than 90% purity as determined by SDS-PAGE, suitable for functional and structural studies .

How can researchers effectively visualize yciB localization and cell division defects in mutant strains?

Multiple complementary techniques can be employed to visualize yciB localization and associated cell division defects:

• Membrane visualization using SynaptoRedC2/FM4-64 staining to clearly observe septum formation in wild-type and mutant cells

• Immunolabeling with FtsZ-specific antibodies and fluorophore-conjugated secondary antibodies to monitor Z-ring formation and integrity

• Peptidoglycan synthesis labeling using:

  • NADA (fluorescent D-amino acid analog of D-alanine) to visualize previously synthesized peptidoglycan

  • EDA-DA (ethynyl-D-alanyl-D-alanine) to specifically track newly synthesized peptidoglycan

• Western blotting to confirm protein expression levels and ensure observed phenotypes are not due to protein degradation

These approaches collectively provide comprehensive visualization of septum formation, Z-ring assembly, and peptidoglycan synthesis patterns, enabling detailed characterization of cell division defects in yciB mutant strains.

What proteins interact with yciB and what genetic interactions have been established?

YciB demonstrates significant functional interactions with several proteins involved in cell division and cell envelope biogenesis:

• DcrB (inner membrane lipoprotein): Studies show synthetic lethality between yciB and dcrB deletions, indicating functional synergy in maintaining cell envelope integrity

• Components of the divisome:

  • FtsI and FtsQ: Genetic interactions suggest yciB works with these proteins during septum formation

• Cell wall biosynthesis machinery:

  • MrdA: Genetic evidence indicates functional connection to cell wall synthesis

• Cell shape maintenance proteins:

  • MreB: Shows synthetic interactions supporting yciB's role in cell morphology regulation

  • RodZ and RodA: Functional connections to these proteins link yciB to both the elongasome and divisome complexes

These physical and genetic interactions position yciB at the intersection of cell division, cell wall biogenesis, and envelope integrity maintenance processes, explaining the pleiotropic effects observed when yciB function is compromised.

How does yciB deletion affect lipoprotein processing and localization?

The deletion of yciB, particularly in combination with dcrB deletion, has profound effects on lipoprotein processing and localization:

• In yciB dcrB double mutants, the abundant outer membrane lipoprotein Lpp mislocalizes to the inner membrane, forming toxic linkages to peptidoglycan

• This mislocalization appears to result from inefficient lipid modification during the first step of lipoprotein maturation, specifically the Lgt-mediated transacylation step

• The defect is not due to reduced phosphatidylglycerol levels but may be related to altered membrane fluidity or changes in lipid homeostasis

• Both Cpx and Rcs stress response signaling systems are upregulated in response to the resulting envelope stress

These findings suggest that yciB, in conjunction with DcrB, plays an important role in facilitating proper lipoprotein maturation and correct localization to the outer membrane, particularly for the abundant Lpp protein.

What approaches can be used to investigate the molecular mechanism of yciB in Z-ring stabilization?

To investigate the molecular mechanism by which yciB contributes to Z-ring stabilization, researchers could employ the following advanced approaches:

• Site-directed mutagenesis of key residues in the tetrameric α-helical coiled-coil domain to identify specific interaction sites with FtsZ and other divisome components

• In vitro reconstitution assays using purified components to assess direct binding between yciB and FtsZ

• FRET or BiFC (Bimolecular Fluorescence Complementation) assays to visualize protein-protein interactions in vivo

• Cryo-electron microscopy of Z-rings in wild-type versus ΔyciB cells to characterize structural differences

• Pull-down assays coupled with mass spectrometry to identify the complete interactome of yciB during different stages of cell division

• Time-lapse fluorescence microscopy with labeled FtsZ and yciB to track their dynamics during septum formation

These approaches would provide mechanistic insights into how yciB contributes to Z-ring stabilization and proper assembly of the divisome complex during bacterial cell division.

How might yciB function differ across various growth conditions and stress responses?

Investigation of yciB function across different growth conditions and stress responses requires systematic experimental approaches:

• Gene expression profiling under various environmental conditions (nutrient limitation, pH stress, osmotic stress) to determine if yciB expression is regulated by specific stress response pathways

• Phenotypic characterization of ΔyciB strains under these varied conditions:

  • Growth rate and viability measurements

  • Cell morphology analysis

  • Antibiotic susceptibility profiles

• Systematic analysis of genetic interactions with stress response regulators and effectors

• Proteomic analysis to identify post-translational modifications of yciB under different stress conditions

• Membrane fluidity measurements in wild-type versus ΔyciB strains under different growth conditions

Current evidence indicates that yciB deletion strains show different sensitivities to antibiotics depending on growth phase, suggesting growth phase-dependent functions . Additionally, the potential role of yciB in membrane fluidity regulation suggests it may have particularly important functions during cold stress or membrane perturbation conditions .

How can researchers reconcile conflicting models of yciB function in cell division versus envelope integrity?

The dual roles of yciB in cell division and envelope integrity present an apparent contradiction that researchers can address through several experimental approaches:

• Temporal studies using inducible expression systems to distinguish primary from secondary effects of yciB deletion

• Creation of separation-of-function mutations that affect only one aspect of yciB function

• Systematic suppressor screens to identify genetic pathways that can compensate for specific aspects of yciB function

• Comparative studies of yciB homologs across different bacterial species to identify conserved versus specialized functions

• Integrated approaches combining structural, genetic, and biochemical methods to develop a unified model

What is the significance of the yciB-dcrB genetic interaction and how does it relate to cold sensitivity?

The synthetic lethality between yciB and dcrB deletions represents an important yet incompletely understood genetic interaction. Research approaches to explore this relationship should include:

• Investigation of membrane properties in single and double mutants:

  • Lipid composition analysis

  • Membrane fluidity measurements at different temperatures

  • Assessment of protein diffusion rates in the membrane

• Identification of temperature-dependent phenotypes:

  • Growth studies at reduced temperatures (evidence shows dcrB null mutants are not viable at low temperatures that impact membrane fluidity)

  • Lipoprotein maturation efficiency at various temperatures

  • Analysis of cold-induced changes in yciB and DcrB protein-protein interactions

• Suppressor analysis:

  • Current evidence shows that dcrB null-mediated toxicity, like yciB dcrB double mutant toxicity, can be overcome by:

    • Increased expression of Lgt (phosphatidylglycerol:preprolipoprotein diacylglyceryl transferase)

    • Deletion of lpp

    • Removal of Lpp-peptidoglycan linkages

These observations suggest that the synthetic lethality arises from combined effects on membrane properties that impair lipoprotein processing, particularly at low temperatures where membrane fluidity is already reduced.

What are the most promising therapeutic implications of targeting yciB function?

Given yciB's role in fundamental cellular processes, several therapeutic applications warrant investigation:

• Development of yciB inhibitors as potential antimicrobials:

  • ΔyciB strains show hypersensitivity to cell wall-targeting antibiotics, suggesting yciB inhibition could potentiate existing antibiotics

  • The unique tetrameric structure of yciB offers potential binding sites for small molecule inhibitors

  • As a conserved protein across gamma-proteobacteria, yciB inhibitors might have broad-spectrum activity

• Exploiting the synthetic lethality between yciB and other cellular components:

  • Combination therapies targeting both yciB and interacting proteins like DcrB

  • Agents that simultaneously disrupt membrane properties and inhibit yciB function

• Potential for attenuated live vaccine development:

  • Controlled yciB expression to create strains with compromised envelope integrity that maintain immunogenicity

These applications remain theoretical until more comprehensive understanding of yciB function across different bacterial species is established. The conservation of yciB across gamma-proteobacteria suggests potential broad therapeutic applications, but species-specific differences require careful characterization.

What technologies and methodological advances would accelerate research on yciB function?

Several technological advances would significantly enhance research into yciB function:

• Development of high-throughput screening assays for yciB interaction partners and inhibitors

• Application of super-resolution microscopy techniques to visualize yciB localization during different stages of cell division

• Implementation of targeted proteomics approaches to quantify changes in the divisome and elongasome complexes in yciB mutants

• Development of in vitro reconstitution systems for studying divisome assembly with purified components

• Application of CRISPRi-based genetic interaction mapping to systematically identify synthetic genetic interactions with yciB across diverse growth conditions

• Use of high-throughput phenotypic profiling technologies to characterize yciB function across diverse bacterial species

These methodological advances would address current limitations in understanding the precise molecular mechanisms by which yciB contributes to cell division and envelope integrity, potentially revealing new therapeutic targets or biotechnological applications.