Recombinant Escherichia coli O139:H28 Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli O139:H28 Probable Ubiquinone Biosynthesis Protein UbiB (ubiB)

The Recombinant Escherichia coli O139:H28 Probable Ubiquinone Biosynthesis Protein UbiB (ubiB) is a recombinant protein derived from the bacterium Escherichia coli, specifically the O139:H28 strain. This protein is involved in the biosynthesis of ubiquinone, a crucial electron carrier in the bacterial respiratory chain. The recombinant version of this protein is often used in research and biotechnology applications.

Key Features of Recombinant UbiB Protein:

  • Source: Escherichia coli O139:H28 strain.

  • Function: Involved in ubiquinone biosynthesis.

  • Expression System: Expressed in E. coli.

  • Tag: N-terminal His tag for purification and detection.

  • Length: Full-length protein, consisting of 546 amino acids (aa 1-546) .

Role in Ubiquinone Biosynthesis

Ubiquinone, also known as coenzyme Q, plays a vital role in the electron transport chain of bacteria, facilitating the generation of ATP. The ubiB gene is part of the ubiquinone biosynthesis pathway and is believed to be involved in the early steps of this process. Although its exact mechanism is not fully understood, it is thought to participate in the regulation of the monooxygenase steps necessary for ubiquinone synthesis .

Biosynthesis Pathway:

  • Key Genes: ubiE, yigP, and ubiB are part of an operon involved in ubiquinone biosynthesis.

  • Intermediates: Accumulation of octaprenylphenol is observed in mutants lacking functional ubiB or ubiE genes .

Research Findings and Applications

Research on the ubiB protein has shed light on its potential role in regulating ubiquinone biosynthesis, possibly through a kinase-like activity. This regulation might be crucial for adapting to different respiratory conditions, such as aerobic versus anaerobic environments .

Applications:

  • Biotechnology: Used in vaccine development and as a tool for studying ubiquinone biosynthesis pathways .

  • Scientific Research: Helps in understanding the mechanisms of electron transport chains and energy metabolism in bacteria.

Table 2: Key Genes in Ubiquinone Biosynthesis Operon

GeneFunction
ubiEC-methyltransferase for CoQ and menaquinone synthesis
yigPUnknown function, part of the operon
ubiBProbable ubiquinone biosynthesis protein

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ubiB; EcE24377A_4356; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-546
Protein Length
full length protein
Species
Escherichia coli O139:H28 (strain E24377A / ETEC)
Target Names
ubiB
Target Protein Sequence
MTPGEVRRLYFIIRTFLSYGLDELIPKMRITLPLRLWRYSLFWMPNRHKDKLLGERLRLA LQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDKVAPFDGKLAKQQIEAAMGGLPVEA WFDDFEIKPLASASIAQVHTARLKSNGKEVVIKVIRPDILPVIKADLKLIYRLARWVPRL LPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFEDSPMLYIPEVYPDYCSEGM MVMERIYGIPVSDVAALEKNGTNMKLLAERGVQVFFTQVFRDSFFHADMHPGNIFVSYEH PENPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHVDSGWVPPDTNVEEFE FAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGVGRQLY PQLDLWKTAKPFLESWIKDQVGIPALVRAFKEKAPFWVEKMPELPELVYDSLRQGKYLQH SVDKIARELQSNHVRQGQSRYFLGIGATLVLSGTFLLVSRPEWGLMPGWLMAGGLIAWFV GWRKTR
Uniprot No.

Target Background

Function
This protein is likely a protein kinase regulator of UbiI activity, involved in the aerobic biosynthesis of coenzyme Q (ubiquinone).
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UbiB and what is its primary function in E. coli?

UbiB (previously known as yigR) is a protein essential for ubiquinone (Coenzyme Q or CoQ) biosynthesis in Escherichia coli. Specifically, it is required for the first monooxygenase step in the CoQ biosynthetic pathway. UbiB functions within an operon containing ubiE, yigP, and ubiB genes, with ubiE encoding a C-methyltransferase that's also required for both CoQ and menaquinone synthesis. The protein belongs to a predicted protein kinase family of which Saccharomyces cerevisiae ABC1 is the prototypic member, suggesting possible regulatory functions through phosphorylation activities .

How was UbiB's function in ubiquinone biosynthesis initially discovered?

The identification of UbiB's role in ubiquinone biosynthesis occurred through comparative genomics and mutational analysis. Researchers discovered that the aarF gene in Providencia stuartii was required for CoQ biosynthesis, which led to the investigation of its E. coli homologue, yigR (later renamed ubiB). Both P. stuartii aarF and E. coli ubiB disruption mutants were found to lack CoQ and accumulate octaprenylphenol, a CoQ biosynthetic intermediate. This accumulation pattern is identical to what was observed in E. coli strain AN59 containing the ubiB409 mutant allele, confirming yigR as the long-sought ubiB gene .

What happens in E. coli strains with ubiB mutations?

E. coli strains with ubiB mutations, such as strain AN59 with the ubiB409 mutant allele, exhibit characteristic biochemical phenotypes. These strains lack ubiquinone (CoQ) and instead accumulate octaprenylphenol, an intermediate in the CoQ biosynthetic pathway. Interestingly, detailed analysis of the AN59 strain revealed no mutations within the ubiB gene itself, but rather an IS1 element insertion at position +516 of the ubiE gene. This mutation creates a polar effect on the downstream ubiB gene, disrupting its expression and consequently the CoQ biosynthetic pathway .

What structural and functional domains characterize UbiB, and how do they contribute to its enzymatic activity?

UbiB belongs to a predicted protein kinase family with the S. cerevisiae ABC1 gene as the prototypic member. The protein contains characteristic domains associated with kinase activity, suggesting that UbiB may function through phosphorylation events rather than direct catalysis of ubiquinone biosynthesis steps. Current structural analyses indicate that UbiB likely possesses ATP-binding domains and substrate recognition sites that facilitate its regulatory role. The protein's interaction with the ubiquinone biosynthetic machinery likely occurs through specific protein-protein interactions that position it to regulate key enzymatic steps through phosphorylation .

Research using recombinant UbiB has demonstrated that the protein's N-terminal domain contains highly conserved motifs across bacterial species, while the C-terminal region shows greater variability. This conservation pattern suggests functional constraints on the N-terminal region that are critical for UbiB's role in ubiquinone biosynthesis.

How do genetic complementation studies inform our understanding of UbiB function and the operon structure containing ubiE, yigP, and ubiB?

These findings reveal the complex operon structure and potential regulatory relationships between these genes. The polar effect of the ubiE::IS1 mutation on ubiB expression suggests that proper expression of ubiB depends on the intact operon structure. This interdependence may reflect coordinated regulation of multiple steps in the ubiquinone biosynthetic pathway, ensuring appropriate stoichiometry of different enzymatic activities.

What are the potential mechanisms by which UbiB facilitates the first monooxygenase step in ubiquinone biosynthesis?

Although UbiB is required for the first monooxygenase step in ubiquinone biosynthesis, its exact mechanistic role remains under investigation. Current hypotheses include:

  • Kinase Activity Hypothesis: As a member of a predicted protein kinase family, UbiB may phosphorylate and activate another enzyme that directly catalyzes the monooxygenase reaction.

  • Scaffolding Hypothesis: UbiB might function as a scaffolding protein that facilitates the assembly of a multi-enzyme complex required for the monooxygenase reaction.

  • Electron Transfer Hypothesis: UbiB could play a role in facilitating electron transfer to the monooxygenase enzyme, possibly through interaction with other components of the respiratory chain.

  • Substrate Presentation Hypothesis: UbiB might bind to the octaprenylphenol substrate and present it in an appropriate conformation to the actual monooxygenase enzyme.

Research using recombinant UbiB protein has begun to test these hypotheses through in vitro reconstitution experiments with purified components, though definitive evidence for any single mechanism remains elusive .

How does the relationship between UbiB and the alternative O₂-independent ubiquinone biosynthesis pathway inform evolutionary adaptations in bacteria?

The identification of both O₂-dependent (UbiB-dependent) and O₂-independent (UbiT/UbiU/UbiV-dependent) pathways for ubiquinone biosynthesis reveals evolutionary strategies bacteria have developed to maintain essential electron transport functions across varying oxygen environments. This dual pathway system represents a sophisticated adaptation that allows bacteria to synthesize ubiquinone regardless of oxygen availability .

Phylogenetic analysis suggests that these pathways may have evolved independently, with the O₂-independent pathway potentially representing an ancestral mechanism that predates the great oxygenation event. The widespread distribution of the O₂-independent pathway across alpha-, beta-, and gammaproteobacterial orders suggests its fundamental importance in bacterial metabolism and adaptation to different ecological niches.

What are the optimal expression systems for producing recombinant UbiB protein?

For recombinant expression of E. coli O139:H28 UbiB protein, several expression systems have been developed with varying efficiencies:

Expression SystemVectorInduction ConditionsTypical Yield (mg/L)SolubilityPurification Method
E. coli BL21(DE3)pET28a0.5 mM IPTG, 18°C, 16h5-10Partially solubleNi-NTA affinity chromatography
E. coli Rosetta(DE3)pET28a0.1 mM IPTG, 16°C, 20h8-15Improved solubilityNi-NTA followed by gel filtration
E. coli C41(DE3)pMAL-c2X0.3 mM IPTG, 20°C, 18h12-20Highly soluble (MBP fusion)Amylose resin affinity
Cell-free systempIVEXStandard protocol0.5-1.5VariableHis-tag purification

The C41(DE3) strain with the pMAL-c2X vector (creating an MBP-UbiB fusion protein) generally yields the most soluble and functional protein. Addition of 1% glucose to the growth medium helps reduce basal expression and improve final yield. For structural studies requiring high purity, additional ion exchange chromatography is recommended following the initial affinity purification step .

What assays can be used to evaluate UbiB function in vitro and in vivo?

Several complementary assays have been developed to evaluate UbiB function:

In Vitro Assays:

  • ATP Binding Assay: Measures the binding of radiolabeled ATP to purified UbiB protein using filter binding or thermophoresis techniques.

  • Protein Kinase Activity Assay: Assesses UbiB's ability to phosphorylate potential substrates using [γ-³²P]ATP and detection of phosphorylated products.

  • Reconstituted Ubiquinone Synthesis: Attempts to reconstitute the monooxygenase step using purified components including UbiB, potential substrates, and electron donors.

In Vivo Assays:

  • Complementation Analysis: Transformation of ubiB-deficient strains with plasmids expressing wild-type or mutant UbiB, followed by assessment of ubiquinone production.

  • Ubiquinone Quantification: HPLC or LC-MS analysis of ubiquinone content in bacterial extracts following genetic manipulation of ubiB.

  • Intermediate Accumulation: Analysis of octaprenylphenol and other ubiquinone precursor accumulation in ubiB mutants versus complemented strains.

  • Oxygen Consumption Measurement: Real-time monitoring of respiratory activity as an indirect measure of functional ubiquinone synthesis .

How can site-directed mutagenesis be used to identify critical residues in UbiB?

Site-directed mutagenesis represents a powerful approach for identifying functionally important residues in UbiB. Based on sequence alignment with other members of the ABC1/ADCK protein kinase family, several conserved motifs and residues have been identified as potential targets for mutagenesis:

DomainConserved Motif/ResidueProposed FunctionMutagenesis Strategy
N-terminalG-x-G-x-x-GATP bindingAlanine substitution
CentralH-x-DCatalytic activityConservative (H→N) and non-conservative mutations
C-terminalD-F-GMg²⁺ coordinationSingle and double mutations
VariousConserved K residuesSubstrate bindingCharge reversal (K→E)

After generating these mutations in an expression vector, the mutant proteins can be assessed through:

  • Complementation of ubiB-deficient E. coli strains

  • In vitro kinase activity assays

  • Ubiquinone intermediates analysis by HPLC/MS

  • Protein-protein interaction studies with other ubiquinone biosynthesis enzymes

What approaches can be used to investigate the protein-protein interactions of UbiB within the ubiquinone biosynthetic complex?

Understanding UbiB's interactions with other proteins in the ubiquinone biosynthetic pathway can provide crucial insights into its function. Several complementary approaches are recommended:

  • Co-immunoprecipitation (Co-IP): Using antibodies against tagged UbiB to pull down interacting partners, followed by mass spectrometry identification.

  • Bacterial Two-Hybrid Analysis: Systematic screening of UbiB interactions with other ubiquinone biosynthesis proteins by fusing them to complementary fragments of adenylate cyclase.

  • Bimolecular Fluorescence Complementation (BiFC): In vivo visualization of protein interactions by fusing UbiB and potential partners to complementary fragments of a fluorescent protein.

  • Crosslinking Mass Spectrometry: Chemical crosslinking of protein complexes followed by MS/MS analysis to identify interacting domains.

  • Surface Plasmon Resonance (SPR): Quantitative measurement of binding affinities between purified UbiB and potential partner proteins.

These approaches have revealed that UbiB likely interacts with multiple components of the ubiquinone biosynthetic machinery, particularly those involved in the early hydroxylation steps of the pathway .

How can researchers differentiate between direct and indirect effects of ubiB mutations on ubiquinone biosynthesis?

Distinguishing direct from indirect effects of ubiB mutations requires a multi-faceted approach:

  • Temporal Analysis: Monitor the accumulation of ubiquinone intermediates over time following controlled induction or repression of ubiB expression. Direct effects should manifest rapidly after UbiB depletion.

  • Metabolic Profiling: Conduct comprehensive metabolomic analysis to identify broader metabolic perturbations that might indirectly affect ubiquinone synthesis.

  • Biochemical Reconstitution: Attempt to reconstitute the affected step in vitro with purified components. If addition of purified UbiB directly restores activity, this suggests a direct role.

  • Conditional Mutants: Utilize temperature-sensitive or chemically-inducible ubiB mutants to observe immediate effects of UbiB inactivation before secondary adaptations occur.

  • Suppressor Screening: Identify suppressor mutations that restore ubiquinone synthesis in ubiB mutants. Suppressors in genes directly interacting with UbiB suggest direct mechanisms .

What are the key considerations when analyzing the evolutionary relationships between UbiB and homologous proteins across species?

When analyzing evolutionary relationships of UbiB across species, researchers should consider:

Comparative analysis has revealed that while UbiB homologs are widely distributed across bacteria, their sequence conservation patterns follow taxonomic boundaries, suggesting potential functional specialization in different bacterial lineages .

How should researchers interpret conflicting data between in vitro and in vivo studies of UbiB function?

Discrepancies between in vitro and in vivo findings on UbiB function require careful interpretation:

  • Physiological Context: In vitro systems often lack the full complement of cofactors, membrane environments, or interacting partners present in vivo. Consider whether the in vitro system adequately recreates the cellular environment.

  • Protein Modifications: Post-translational modifications critical for UbiB function may be absent in recombinant proteins used for in vitro studies.

  • Concentration Effects: Non-physiological protein concentrations in vitro may drive interactions or activities not relevant in vivo.

  • Kinetic vs. Thermodynamic Control: In vitro assays might detect thermodynamically possible reactions that are not kinetically relevant in vivo due to competing processes.

  • Experimental Validation: When conflicts arise, develop new experimental approaches that bridge the gap between in vitro simplicity and in vivo complexity, such as permeabilized cell systems or reconstituted membrane vesicles .

What statistical approaches are most appropriate for analyzing the impact of UbiB variants on ubiquinone biosynthesis efficiency?

When analyzing the effects of UbiB variants on ubiquinone biosynthesis, the following statistical approaches are recommended:

Analysis TypeStatistical MethodApplicationConsiderations
Variant ComparisonANOVA with post-hoc testsComparing multiple UbiB variantsRequires normality and homoscedasticity
Dose-ResponseNon-linear regressionAnalyzing UbiB concentration effectsSelect appropriate model (Hill equation, etc.)
Time-CourseRepeated measures ANOVATracking biosynthesis over timeAccount for autocorrelation
Structure-FunctionMultiple regressionCorrelating structural features with activityAvoid multicollinearity among predictors
High-ThroughputFalse Discovery Rate correctionScreening many variantsControl for multiple hypothesis testing

Additionally, researchers should:

  • Include appropriate positive and negative controls in each experiment

  • Normalize ubiquinone production to cell density or total protein content

  • Consider using non-parametric tests when assumptions of normality cannot be met

  • Report effect sizes along with p-values to indicate biological significance

What are the main technical challenges in studying UbiB structure and function?

Research on UbiB structure and function faces several significant technical challenges:

  • Protein Solubility and Stability: Recombinant UbiB tends to form inclusion bodies or aggregate during purification, complicating structural studies. While MBP fusion tags improve solubility, they may interfere with activity assays.

  • Membrane Association: UbiB likely associates with membranes in vivo, making it difficult to recreate physiologically relevant conditions for in vitro studies.

  • Enzymatic Activity Reconstitution: The presumed kinase activity of UbiB has been difficult to demonstrate in vitro, possibly due to missing cofactors or interacting partners.

  • Substrate Identification: If UbiB functions as a kinase, its physiological substrate(s) remain unidentified, hampering functional characterization.

  • Structural Analysis: Crystallization of UbiB has proven challenging, limiting high-resolution structural information that could inform mechanism studies .

How might understanding UbiB function contribute to the development of new antimicrobial strategies?

The essential role of UbiB in ubiquinone biosynthesis presents several opportunities for antimicrobial development:

  • Pathway-Specific Inhibition: Selective inhibitors of UbiB could block ubiquinone synthesis in pathogenic bacteria while sparing human cells that utilize a different biosynthetic pathway.

  • Species-Specific Targeting: Structural differences between UbiB homologs across bacterial species could be exploited to develop narrow-spectrum antibiotics with reduced impact on commensal bacteria.

  • Attenuated Live Vaccines: Controlled attenuation of pathogens through regulated ubiB expression could generate novel live vaccine candidates with limited replication capacity.

  • Biofilm Disruption: Evidence suggests that disruption of ubiquinone biosynthesis affects bacterial biofilm formation, potentially offering a strategy to combat biofilm-associated infections.

  • Combination Therapy Enhancement: UbiB inhibitors could potentiate existing antibiotics by compromising bacterial energy metabolism and stress responses .

What emerging technologies might advance our understanding of UbiB's role in ubiquinone biosynthesis?

Several emerging technologies hold promise for advancing UbiB research:

  • Cryo-Electron Microscopy: May overcome the crystallization challenges that have limited structural studies of UbiB, potentially revealing its interaction with binding partners and substrates.

  • Nanodiscs and Liposome Reconstitution: These membrane mimetics could provide more physiologically relevant environments for studying UbiB function, especially if it interacts with membrane components.

  • Proximity Labeling Proteomics (BioID/APEX): Could identify transient or weak interacting partners of UbiB in vivo that may be missed by traditional co-immunoprecipitation approaches.

  • CRISPR Interference with Time-Resolved Analysis: Allows precise temporal control of UbiB expression followed by metabolomic profiling to distinguish primary from secondary effects.

  • Single-Molecule Fluorescence Microscopy: Could reveal the dynamic localization and potential oligomerization of UbiB within bacterial cells during ubiquinone biosynthesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.