Recombinant Escherichia coli O139:H28 Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics

Molecular Function:

  • Catalyzes the first step in lipoprotein maturation via diacylglyceryl transfer to the conserved cysteine residue of prolipoproteins .

  • Essential for E. coli survival, as shown by lethal phenotypes in lgt depletion strains .

In Vitro Assays:

  • Recombinant EcLgt demonstrated diacylglyceryl transferase activity using a fluorescent lipoGFP substrate .

  • Activity depends on phosphatidylglycerol as the lipid donor .

Critical Residues:

ResidueRoleImpact of Mutation
Y26Stabilizes substrate bindingLoss of function
N146Facilitates catalytic transferComplete inactivation
R239Electrostatic interactionReduced activity

Functional Essentiality

  • Genetic Depletion Studies: Conditional lgt knockout strains fail to grow unless rescued by functional Lgt .

  • Phenotypic Effects: Lgt inhibition causes accumulation of unmodified prolipoproteins, OM blebbing, and increased cell size .

Inhibitor Studies

Novel macrocyclic inhibitors (e.g., G2823 and G2824) target Lgt with the following effects:

InhibitorTarget SpecificityMIC (μg/mL)Key Findings
G2823Lgt-dependent E. coli4–8Accumulates pro-Lpp, induces OM defects
G2824Cross-species (e.g., A. baumannii)8–16Synergistic with CRISPRi knockdown

Research Applications

  • Recombinant Protein Use: Employed in structural studies (e.g., crystallization with palmitic acid) and inhibitor screening .

  • Biochemical Tools: Used to dissect lipoprotein biogenesis pathways and validate antibiotic targets .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the intrinsic stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
lgt; EcE24377A_3148; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Escherichia coli O139:H28 (strain E24377A / ETEC)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPEFDPVIFSIGPVALHWYGLMYLVGFIFAMWLATRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPQFMADPLYLFRVWDGGMSFHGGLIGVIVVMIIFARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPNFPFAMLFPGSRTEDILLLQTN PQWQSIFDTYGVLPRHPSQLYELLLEGVVLFIILNLYIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIVAGVIMMVWAYRRSPQQHVS
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, the first step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of lgt in bacterial lipoprotein processing?

Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the first critical step in bacterial lipoprotein maturation. It transfers a diacylglyceryl moiety, derived from phosphatidylglycerol, to the thiol group of a conserved cysteine residue (position +1) in prolipoproteins. This reaction results in the formation of a thioether-linked diacylglyceryl-prolipoprotein and glycerolphosphate as a by-product . This modification is essential for subsequent processing steps, including signal peptide cleavage by signal peptidase II (Lsp) and N-acylation by apolipoprotein N-acyltransferase (Lnt) .

The reaction represents a direct transfer of the diacylglyceryl moiety from phosphatidylglycerol to the conserved amino-terminal cysteine residue of the prolipoprotein. This process differs from earlier models that proposed a stepwise glycerylation followed by acylation . The molecular mechanism involves a specific recognition of the lipobox sequence in target prolipoproteins, ensuring selective modification of proteins destined for membrane anchoring.

How is lgt genetically characterized and what domains are critical for its function?

Lgt proteins are characterized by a distinctive prolipoprotein diacylglyceryl transferase signature sequence, identified as PS01311 in the Prosite database . The enzyme contains multiple transmembrane domains that anchor it to the bacterial inner membrane, with catalytic regions positioned to interact with both the lipid substrate and the target prolipoprotein.

Key functional domains include:

Domain/ResidueFunctional SignificanceExperimental Evidence
Conserved cysteine residuesPotential involvement in catalytic mechanism or structural integritySite-directed mutagenesis studies
Aspartic acid residues (e.g., D129)Likely role in catalytic activityMutagenesis with D129A substitution
Transmembrane segmentsMembrane anchoring and substrate accessSolubilization studies with detergents and chaotropic agents

Researchers have employed site-directed mutagenesis to generate various cysteine and alanine mutants to investigate structure-function relationships, with mutations cloned into expression vectors such as pBAD18s and pAM238 .

What are the optimal approaches for creating and confirming lgt gene knockouts?

Creating reliable lgt knockout mutants requires strategic approaches due to the essential nature of this gene in many Gram-negative bacteria. A successful methodology involves:

  • Design of construct with flanking homologous regions (~1.5 kb) surrounding lgt

  • Replacement of an internal fragment of lgt with an antibiotic resistance cassette (e.g., spectinomycin)

  • Use of temperature-sensitive shuttle vectors for efficient transformation

  • Selection of transformants through temperature shifts and antibiotic pressure

An effective protocol demonstrated in Streptococcus suis involved:

  • PCR amplification of a chromosomal DNA fragment containing the intact lgt gene with 1.5 kb flanking regions

  • Cloning into a vector (e.g., pJET1.2)

  • Using inverse PCR to replace ~300 bp of the lgt gene with a spectinomycin resistance cassette

  • Transferring the construct to a thermosensitive shuttle vector (e.g., pSET5)

  • Introduction into the target strain via electroporation

  • Selection of transformants at 30°C with spectinomycin

  • Temperature shift to 38°C to promote chromosomal integration

Confirmation of knockout should include PCR verification using primers that flank the integration site, Southern blotting, and phenotypic analysis of lipoprotein processing defects .

What methods can be used to solubilize and purify functional lgt for in vitro studies?

Solubilization of membrane-bound Lgt presents significant challenges due to its multiple transmembrane domains. Effective solubilization approaches include:

Solubilization AgentConcentrationEffectivenessNotes
N-octyl-β-D-glucoside (β-OG)1%HighMaintains enzymatic activity
Urea4-8 MModerateMay compromise folding
NaCl0.75 MLowMinimal solubilization

The recommended protocol involves:

  • Preparation of membrane vesicles from E. coli expressing recombinant lgt

  • Resuspension in TED buffer (20 mM Tris-HCl, pH 8.0, 1.25 mM EDTA, 2 mM DTT)

  • Addition of solubilization agent (preferably 1% β-OG)

  • Incubation for 1 hour at 4°C

  • Ultracentrifugation (135,000 × g for 30 minutes) to separate solubilized proteins

  • Analysis by SDS-PAGE and immunoblotting

For maintaining enzymatic activity, detergent-based solubilization with β-OG is generally preferred over chaotropic agents such as urea.

How can researchers differentiate between phenotypes caused by lgt deficiency versus other lipoprotein processing enzymes?

Distinguishing lgt-specific phenotypes from those caused by other lipoprotein processing enzymes (Lsp, Lnt) requires multiple complementary approaches:

  • Western blot analysis of lipoprotein intermediates:

    • Lgt inhibition/deletion results in accumulation of unmodified prolipoproteins

    • LspA inhibition causes accumulation of diacylglyceryl-modified pro-Lpp (DGPLP)

    • These distinct patterns can be visualized using SDS fractionation to separate peptidoglycan-associated proteins (PAP) and non-PAP fractions

  • Subcellular localization studies:

    • Lgt inhibition leads to accumulation of a ~14 kDa Lpp isoform in the inner membrane, distinct from patterns seen with other inhibitors

    • Sucrose gradient centrifugation and sarkosyl solubilization can effectively separate inner and outer membrane fractions

  • CRISPR interference (CRISPRi) approaches:

    • Targeted downregulation of specific genes (lgt, lspA, lolC) yields distinctive sensitization patterns

    • Cells with decreased lgt expression show increased sensitivity to Lgt inhibitors but not to LspA or LolCDE inhibitors

    • This specificity confirms target engagement and helps differentiate between pathways

  • Complementation studies:

    • Reintroduction of functional lgt on expression plasmids (e.g., pGA14-lgt-expr-cm) should rescue phenotypes if they are specifically caused by lgt deficiency

    • Confirmation of gene expression by quantitative real-time PCR ensures successful complementation

What strategies exist for developing and validating lgt inhibitors as research tools?

Development of specific lgt inhibitors presents valuable research tools for studying lipoprotein processing. Effective strategies include:

  • Biochemical screening approaches:

    • In vitro assays measuring transfer of diacylglyceryl moiety from phosphatidylglycerol to synthetic peptide substrates

    • Fluorescence-based detection methods for high-throughput screening

  • Validation of inhibitor specificity:

    • Analysis of Lpp intermediate accumulation profiles using Western blots

    • Comparison with known inhibitors of related enzymes (e.g., globomycin for LspA)

    • Monitoring cellular phenotypes (outer membrane blebbing, cell size increases)

  • Genetic approaches for target confirmation:

    • CRISPRi-mediated downregulation of lgt to confirm specific sensitization to inhibitors

    • Expression of inhibitor-resistant lgt variants, if available

    • Cross-resistance studies with inhibitors of other lipoprotein processing enzymes

The macrocyclic compounds G2823 and G2824 represent validated Lgt inhibitors that interfere with enzymatic activity in vitro and demonstrate bactericidal effects against E. coli. These compounds induce characteristic phenotypes including:

  • Accumulation of prolipoprotein

  • Outer membrane blebbing

  • Increased cell size

  • Altered peptidoglycan-Lpp association

What are common challenges in monitoring lgt activity and how can they be overcome?

Monitoring Lgt enzymatic activity presents several technical challenges:

ChallengeSolutionMethodology
Detection of reaction intermediatesSDS fractionationSeparate PG-associated proteins (PAP) and non-PAP fractions; add lysozyme to identify PG-linked Lpp forms
Distinguishing Lpp formsWestern blot analysisUse specific antibodies that recognize different Lpp forms; the triacylated mature form appears as the fastest migrating band, while PG-linked forms migrate more slowly
Membrane protein solubilityOptimized detergent conditionsUse N-octyl-β-D-glucoside (β-OG) at 1% concentration in TED buffer
Confirming on-target activityCombined genetic/biochemical approachEmploy CRISPRi to decrease lgt expression and confirm specific sensitization to inhibitors

A particularly effective approach involves monitoring the accumulation of specific Lpp forms by Western blot analysis. The various forms can be identified by their characteristic migration patterns:

  • Triacylated mature Lpp: fastest migrating form

  • PG-linked Lpp forms: slower migration

  • PG-linked diacylglyceryl modified pro-Lpp (DGPLP): intermediate migration

How can researchers effectively complement lgt mutations for functional validation?

Effective complementation of lgt mutations requires careful consideration of expression levels and proper folding. A validated approach includes:

  • Construction of an expression plasmid containing the wild-type lgt gene with its native promoter:

    • PCR amplification of the intact lgt gene including its putative promoter region

    • Cloning into an appropriate vector (e.g., pJET1.2 followed by subcloning into pGA14)

    • Addition of a selectable marker different from the one used for knockout (e.g., chloramphenicol resistance gene if spectinomycin was used for knockout)

  • Introduction of the complementation plasmid into the Δlgt mutant strain:

    • Standard transformation protocols appropriate for the bacterial species

    • Selection on media containing the appropriate antibiotic

  • Confirmation of successful complementation:

    • Quantitative real-time PCR to verify RNA expression of the lgt gene

    • Western blot analysis to confirm restoration of normal lipoprotein processing

    • Phenotypic assays to verify functional recovery

  • Inclusion of proper controls:

    • Empty vector controls (e.g., Δlgt::pGA14-cm) to account for vector effects

    • Wild-type strain with the same plasmids to control for potential dominant effects

How does lgt inhibition affect broader aspects of bacterial cell envelope integrity?

Lgt inhibition has profound effects on bacterial cell envelope integrity that extend beyond simply blocking lipoprotein maturation:

  • Impact on outer membrane proteins (OMPs):

    • Lgt inhibition significantly affects localization of the β-barrel protein OmpA

    • This is likely due to decreased outer membrane expression of BamD and consequently BamA, which are essential for OMP assembly

    • These effects are similar to those seen with other lipoprotein processing inhibitors (LspAi and LolCDEi)

  • Membrane morphology changes:

    • Treatment with Lgt inhibitors leads to characteristic outer membrane blebbing

    • Cells exhibit measurable increases in size

    • These phenotypes resemble those previously observed in Pal-deficient E. coli strains

  • Peptidoglycan-lipoprotein linkages:

    • Loss of diacylglyceryl modification by Lgt creates less optimal substrates for L,D-transpeptidases that covalently link Lpp to peptidoglycan

    • This disrupts the critical connections between the outer membrane and the cell wall

    • Despite this, some evidence suggests peptidoglycan linkage may still occur after Lgt modification

The extensive nature of these effects suggests that Lgt inhibition provides potential advantages as an antibacterial strategy compared to targeting other steps in the lipoprotein biosynthesis pathway.

What genetic approaches are most effective for studying lgt function in antimicrobial development?

Several genetic approaches have proven particularly valuable for studying lgt function in the context of antimicrobial development:

  • CRISPR interference (CRISPRi) technology:

    • Allows for titratable downregulation of gene expression

    • Creates hypersensitive strains for inhibitor screening

    • Enables target validation by demonstrating specific sensitization

    • Successfully used to decrease expression of lgt, lspA, and lolC genes

  • Complementation systems:

    • Expression of wild-type lgt from plasmids in knockout strains

    • Confirms phenotype specificity and excludes polar effects

    • Can be used to express modified versions of lgt with specific mutations

  • Reporter systems:

    • Tracking accumulation of lipoprotein intermediates via Western blot

    • Monitoring subcellular localization of key lipoproteins

    • Analysis of peptidoglycan-associated proteins versus non-peptidoglycan-associated fractions

These approaches collectively offer powerful tools for validating lgt as an antimicrobial target. Research indicates that therapeutic targeting of Lgt over other steps in the lipoprotein biosynthesis and transport pathways might present a more favorable resistance profile, potentially helping to address the challenge of multi-drug resistant bacterial infections .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.