Recombinant Escherichia coli O139:H28 Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Escherichia coli O139:H28 Protein CrcB Homolog (CrcB)

Escherichia coli (commonly abbreviated as E. coli) is a Gram-negative, facultative anaerobic bacterium that is commonly found in the lower intestine of warm-blooded organisms . E. coli strains are diverse, with some being harmless commensals and others being pathogenic, causing diseases like diarrhea, urinary tract infections, and more serious conditions .

Recombinant Escherichia coli O139:H28 Protein CrcB homolog (CrcB) is a protein produced using recombinant DNA technology . Specifically, the CrcB homolog (crcB) is derived from the E. coli O139:H28 strain, with the "recombinant" aspect indicating that the gene encoding this protein has been cloned and expressed in a host organism, often to produce large quantities of the protein for research or other applications .

Characteristics of CrcB Homolog

The CrcB homolog is related to fluoride-specific ion channel protein FluC . Overexpression of CrcB leads to various effects, including camphor resistance, chromosome condensation, and suppression of growth defects in certain mutants .

Basic Information

CharacteristicDescription
Source OrganismEscherichia coli O139:H28 (strain E24377A / ETEC)
Protein NameProtein CrcB homolog
UniProt IDA7ZJ12
Purity>85% (SDS-PAGE)
SourceBaculovirus
Tag InfoDetermined during manufacturing
Protein LengthPartial

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

Tag type is determined during production. If you require a specific tag, please inform us for preferential development.

Synonyms
crcB; EcE24377A_0649; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Escherichia coli O139:H28 (strain E24377A / ETEC)
Target Names
crcB
Target Protein Sequence
MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANLIGAFIIGMGFAWFSRMTN IDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWL FSASTAH
Uniprot No.

Target Background

Function

Crucial for reducing intracellular fluoride concentration and mitigating its toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the CrcB homolog protein in E. coli O139:H28 and what are its primary functions?

The CrcB homolog in E. coli O139:H28 functions primarily as a fluoride ion channel protein involved in fluoride resistance mechanisms. Unlike colonization factors such as the coli surface-associated antigen 1 (CS1) which are often plasmid-encoded in this serotype, CrcB is typically chromosomally encoded and contributes to bacterial survival in environments containing fluoride ions. The protein forms part of a protective mechanism that prevents fluoride toxicity by exporting fluoride ions from the bacterial cytoplasm, thus maintaining intracellular homeostasis.

When designing experiments to investigate CrcB function, researchers should consider comparative analyses with related homologs in other bacterial species and use genetic complementation studies to validate function. Expression studies should incorporate both chromosomal and plasmid-based systems, as plasmid-encoded elements in E. coli O139:H28 may exhibit regulatory interactions with chromosomal genes .

What are the recommended protocols for expressing recombinant CrcB homolog from E. coli O139:H28?

Expression of recombinant CrcB homolog requires careful optimization of expression systems. Based on methodology principles from similar bacterial membrane proteins, the following protocol is recommended:

  • Vector selection: Use pET-based expression vectors for high-yield expression or pBAD vectors for more controlled expression under the arabinose promoter.

  • Host strain selection: Transform into E. coli BL21(DE3) for high expression yields or into a derivative of strain E24377 without large plasmids to study native regulatory interactions .

  • Expression conditions:

    • Grow cultures at 30°C rather than 37°C to reduce inclusion body formation

    • Induce with 0.5 mM IPTG (for T7-based systems) or 0.2% arabinose (for pBAD systems)

    • Express at 18°C post-induction for 16-20 hours for optimal folding

  • Regulatory considerations: If expression is low or absent, co-transform with a plasmid carrying regulatory elements such as those homologous to the cfaD/rns regulatory system, which has been shown to regulate expression of surface proteins in E. coli O139:H28 .

  • Verification: Confirm expression using Western blotting with anti-His tag antibodies (if using His-tagged constructs) and assess membrane localization using fractionation techniques.

How should researchers design experiments to verify the function of recombinant CrcB homolog in fluoride resistance?

To verify the fluoride resistance function of recombinant CrcB, a systematic experimental approach should be implemented:

  • Growth inhibition assays: Compare growth curves of wild-type, crcB knockout, and crcB-complemented strains in media containing various concentrations of NaF (0-50 mM). Record OD600 measurements at regular intervals (0, 2, 4, 8, 12, 24 hours) .

  • Fluoride uptake measurements: Use fluoride-specific electrodes to measure intracellular vs. extracellular fluoride concentrations.

  • Control variables: Maintain consistent pH (7.2-7.4), temperature (37°C), media composition, inoculum density, and growth phase across all experimental conditions .

  • Data collection design: Implement a data table format as follows:

Strain TypeNaF Concentration (mM)OD600 (0h)OD600 (4h)OD600 (8h)OD600 (12h)OD600 (24h)
WT O139:H2800.050.320.781.451.89
WT O139:H28100.050.290.651.321.76
ΔcrcB00.050.310.761.421.87
ΔcrcB100.050.180.310.450.62
ΔcrcB+pCrcB00.050.300.741.401.85
ΔcrcB+pCrcB100.050.280.631.281.73
  • Statistical analysis: Apply two-way ANOVA to analyze the interaction between strain type and fluoride concentration, followed by post-hoc tests to identify significant differences between conditions .

How should researchers design a comprehensive experimental workflow for isolating and characterizing CrcB from E. coli O139:H28?

A comprehensive experimental workflow for CrcB characterization should include:

  • Gene amplification and cloning:

    • Design primers with appropriate restriction sites

    • PCR amplify the crcB gene from E. coli O139:H28 genomic DNA

    • Clone into expression vectors with affinity tags (His6 or FLAG)

  • Expression optimization:

    • Test multiple expression conditions (temperature, induction time, inducer concentration)

    • Compare membrane vs. soluble fractions to confirm localization

  • Protein purification:

    • Solubilize membranes using mild detergents (DDM, LDAO)

    • Perform affinity chromatography

    • Further purify by size exclusion chromatography

  • Functional characterization:

    • Reconstitute protein in liposomes

    • Perform fluoride transport assays

    • Assess channel conductance using electrophysiology

  • Structural analysis:

    • Analyze secondary structure using circular dichroism

    • Attempt crystallization for X-ray crystallography or prepare for cryo-EM

The experimental design should include appropriate controls at each stage and follow a systematic methodology with a clear rationale for each step . Transformants carrying only structural genes for CrcB may not express the protein, so co-expression with identified regulatory elements should be considered based on the regulatory patterns observed with other surface proteins in E. coli O139:H28 .

What are the critical variables to control when studying the regulatory mechanisms governing CrcB expression in E. coli O139:H28?

When investigating CrcB regulation, control the following variables:

  • Plasmid factors:

    • Copy number of expression plasmids

    • Presence/absence of regulatory sequences homologous to cfaD/rns

    • Compatibility with resident plasmids in the host strain

  • Growth conditions:

    • Culture medium composition (especially ion content)

    • Growth phase (log vs. stationary)

    • Temperature and pH

    • Aeration conditions

  • Host strain characteristics:

    • Presence of competing regulatory networks

    • Background expression of related transporters

    • Strain-specific genetic factors that might influence membrane protein expression

  • Data collection methodology:

    • Use RT-qPCR for transcript analysis

    • Western blotting for protein quantification

    • Fluorescence microscopy for localization studies

    • Flow cytometry for population-level expression analysis

  • Experimental controls:

    • Include a standard of comparison such as a constitutively expressed gene/protein

    • Use strains with known regulatory mutations as reference points

    • Include positive and negative controls for each analytical method

This approach allows for systematic isolation of variables affecting CrcB expression, following principles of good research methodology design .

What methodological approaches are recommended for studying potential interactions between CrcB and other membrane proteins in E. coli O139:H28?

To investigate protein-protein interactions involving CrcB:

  • In vivo approaches:

    • Bacterial two-hybrid system (BACTH) specifically designed for membrane proteins

    • Fluorescence resonance energy transfer (FRET) using fluorescently tagged proteins

    • Co-immunoprecipitation with membrane-compatible detergents

  • In vitro approaches:

    • Pull-down assays using purified components

    • Surface plasmon resonance (SPR)

    • Native PAGE analysis of membrane extracts

  • Genetic approaches:

    • Synthetic lethality screening

    • Suppressor mutation analysis

    • Phenotypic analysis of double knockout strains

  • Data recording and analysis:

    • Document all interaction partners in a systematic table

    • Verify interactions using multiple independent methods

    • Quantify interaction strengths where possible

    • Apply appropriate statistical tests to confirm significance of observed interactions

  • Experimental design considerations:

    • Include proper negative controls (non-interacting membrane proteins)

    • Consider the effect of detergents on interaction stability

    • Account for membrane microdomain effects on protein association

    • Design experiments with multiple technical and biological replicates

How should researchers analyze and interpret contradictory results in CrcB functional studies?

When facing contradictory results in CrcB functional studies:

For example, if fluoride resistance assays show conflicting results, systematically evaluate media composition, growth conditions, and exact genetic backgrounds of the strains used. Document all variables in a comprehensive table to identify potential sources of variation.

What statistical approaches are most appropriate for analyzing CrcB expression data from different experimental conditions?

When analyzing CrcB expression data:

Example data presentation format:

ConditionRelative CrcB Expression (Mean ± SEM)nStatistical Significance
Control1.00 ± 0.086Reference
5 mM NaF2.34 ± 0.216p < 0.01
10 mM NaF3.87 ± 0.316p < 0.001
pH 6.01.56 ± 0.176p < 0.05
pH 8.00.78 ± 0.096p > 0.05

How can researchers effectively document and present complex data sets from CrcB localization and trafficking studies?

For effective documentation and presentation of CrcB localization data:

  • Standardized imaging protocols:

    • Establish consistent microscopy settings (exposure, gain, resolution)

    • Use appropriate controls for autofluorescence and background

    • Include scale bars and time stamps on all images

  • Quantitative image analysis:

    • Measure fluorescence intensity across cellular compartments

    • Track protein movement in time-lapse studies

    • Calculate co-localization coefficients with marker proteins

  • Data organization frameworks:

    • Create multi-panel figures showing representative images alongside quantification

    • Develop heatmaps showing localization patterns across conditions

    • Use line scan analysis to demonstrate membrane vs. cytoplasmic distribution

  • Statistical representation:

    • Present localization data as percentage of cells showing specific patterns

    • Calculate Pearson's or Manders' coefficients for co-localization studies

    • Use box plots or violin plots to show distribution of localization metrics

  • Dynamic data presentation:

    • For trafficking studies, create kymographs showing protein movement over time

    • Present fluorescence recovery after photobleaching (FRAP) data as recovery curves

    • Develop 3D reconstructions for complex subcellular localization patterns

Example data table format:

ConditionMembrane Localization (%)Cytoplasmic Localization (%)Polar Foci (%)n (cells)
WT78.3 ± 5.218.4 ± 3.73.3 ± 1.1245
ΔflhC65.1 ± 6.329.8 ± 4.25.1 ± 1.9231
ΔcheY81.2 ± 4.815.3 ± 3.53.5 ± 1.3253
10mM NaF89.7 ± 3.68.9 ± 2.11.4 ± 0.8238

What methodological approaches can be used to investigate the structural dynamics of CrcB during ion transport?

Advanced methodological approaches for studying CrcB structural dynamics include:

  • Single-molecule techniques:

    • Single-molecule FRET to measure conformational changes

    • Atomic force microscopy (AFM) to probe membrane protein topology

    • Single-channel electrophysiology to monitor gating events

  • Computational approaches:

    • Molecular dynamics simulations of CrcB in membrane environments

    • Homology modeling based on related channel structures

    • In silico docking studies with fluoride and potential inhibitors

  • Spectroscopic methods:

    • Site-directed spin labeling combined with electron paramagnetic resonance (EPR)

    • Hydrogen/deuterium exchange mass spectrometry

    • Solid-state NMR of reconstituted CrcB in nanodiscs

  • Structural biology integration:

    • Design truncation constructs to facilitate crystallization

    • Engineer stabilizing mutations based on computational predictions

    • Use lipidic cubic phase crystallization for membrane proteins

  • Functional correlation studies:

    • Correlate structural data with transport measurements

    • Combine electrophysiology with simultaneous fluorescence imaging

    • Implement cysteine accessibility methods to probe channel gating

When designing these experiments, researchers should carefully control for the effects of tags, fluorophores, or mutations on protein function. Verification of channel activity should be performed in parallel with structural studies to ensure physiological relevance .

How can CRISPR-Cas9 genome editing be optimized for studying CrcB function in E. coli O139:H28?

Optimizing CRISPR-Cas9 genome editing for CrcB studies:

  • Guide RNA design considerations:

    • Select target sites with minimal off-target potential

    • Validate guide RNA efficiency in silico before implementation

    • Design multiple guide RNAs targeting different regions of crcB

  • Delivery optimization:

    • Use temperature-sensitive plasmids for transient Cas9 expression

    • Optimize electroporation parameters specifically for E. coli O139:H28

    • Consider lambda Red recombination system co-expression for improved efficiency

  • Editing strategies:

    • For knockout studies: design repair templates with selectable markers

    • For point mutations: include silent mutations in PAM sites to prevent re-cutting

    • For tagging: ensure tag insertion maintains protein functionality

  • Screening methodology:

    • Develop PCR-based screening protocols for identifying successful edits

    • Implement fluoride sensitivity assays for functional validation

    • Use sequencing to confirm precise edits and rule out off-target effects

  • Controls and validation:

    • Create parallel edits in reference E. coli strains for comparison

    • Complement edited strains to confirm phenotype specificity

    • Verify expression levels of nearby genes to rule out polar effects

Table of recommended parameters for CRISPR-Cas9 editing in E. coli O139:H28:

ParameterRecommended SettingNotes
Guide RNA length20 nucleotidesAvoid homopolymer stretches
PAM siteNGGStandard S. pyogenes Cas9
Cas9 expressionInducible0.2% arabinose for 2-3 hours
Homology arm length500-700 bpFor precise edits
Selection markerKanamycin resistanceFor knockout constructs
Recovery mediumSOC with 0.2% glucoseFor 2 hours post-transformation
Verification methodSanger sequencingOf entire targeted region

What novel approaches can be used to investigate potential roles of CrcB beyond fluoride transport in pathogenic E. coli strains?

To explore novel CrcB functions beyond fluoride transport:

  • Transcriptomic approaches:

    • RNA-seq under diverse stress conditions

    • Differential expression analysis comparing wild-type and ΔcrcB strains

    • Co-expression network analysis to identify functional associations

  • Interactome mapping:

    • Proximity labeling methods (BioID or APEX2)

    • Crosslinking mass spectrometry

    • Membrane-specific yeast two-hybrid screening

  • Phenotypic profiling:

    • High-throughput phenotype microarrays

    • Biofilm formation assays under various conditions

    • Host cell adhesion and invasion studies

  • Metabolomic investigations:

    • Targeted metabolite analysis in WT vs. ΔcrcB strains

    • Isotope labeling to track metabolic flux changes

    • Lipidomic analysis to assess membrane composition alterations

  • In vivo significance studies:

    • Animal infection models comparing WT and ΔcrcB strains

    • Competitive index assays in mixed infections

    • Tissue-specific bacterial gene expression analysis

These approaches should be integrated with plasmid transformation and regulatory studies, particularly considering the regulatory elements identified in E. coli O139:H28 that control surface protein expression . Researchers should apply multi-locus sequence typing (MLST) methods to position their O139:H28 strain within the broader E. coli phylogeny, which can provide context for interpreting CrcB function in relation to pathogenicity .

What are the most common technical challenges in CrcB protein purification and how can they be addressed?

Common challenges in CrcB purification and their solutions:

  • Low expression levels:

    • Try different promoter systems (T7, tac, araBAD)

    • Optimize codon usage for E. coli expression

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

    • Include regulatory elements known to enhance expression in O139:H28

  • Protein instability:

    • Add stabilizing ligands during purification

    • Screen different detergents (DDM, LMNG, GDN)

    • Reduce purification temperature to 4°C throughout

    • Include protease inhibitor cocktails

  • Aggregation issues:

    • Optimize detergent:protein ratio

    • Include glycerol (10-20%) in all buffers

    • Apply on-column folding strategies

    • Consider fusion partners that enhance solubility

  • Contaminating proteins:

    • Implement multi-step purification (IMAC followed by SEC)

    • Use more stringent washing conditions during affinity steps

    • Consider on-column detergent exchange

    • Apply ion exchange as an additional purification step

  • Functional assessment challenges:

    • Develop robust proteoliposome reconstitution protocols

    • Standardize fluoride detection methods

    • Include positive controls (known fluoride transporters)

    • Validate protein folding using circular dichroism

Quality control checkpoints table:

Purification StageQuality Control TestAcceptance CriteriaTroubleshooting
Crude extractWestern blotDetectable band at ~11-12 kDaAdjust induction conditions
Membrane fractionSDS-PAGEEnrichment of target bandOptimize membrane preparation
IMAC eluateSDS-PAGE>60% purityIncrease imidazole in wash buffer
SEC fractionSDS-PAGE>90% purityApply additional purification step
Final productCircular dichroismα-helical spectrumOptimize detergent composition
Reconstituted proteinFluoride transport>2-fold over protein-free liposomesAdjust protein:lipid ratio

What emerging technologies show promise for advancing our understanding of CrcB function and regulation in pathogenic E. coli?

Emerging technologies with potential for CrcB research:

  • Cryo-electron tomography:

    • Visualize CrcB in its native membrane environment

    • Study channel arrangement and clustering

    • Examine structural changes under different ion concentrations

  • Single-cell technologies:

    • Single-cell RNA-seq to identify cell-to-cell variation in crcB expression

    • Microfluidics-based single-cell phenotyping

    • Time-lapse fluorescence microscopy with microfluidic devices

  • Nanopore sequencing applications:

    • Direct RNA sequencing to identify transcription start sites

    • Epigenetic modifications affecting crcB expression

    • Long-read sequencing for genomic context analysis

  • Advanced mass spectrometry:

    • Targeted proteomics to quantify low-abundance CrcB

    • Crosslinking MS for in vivo interaction mapping

    • Native MS to study intact membrane protein complexes

  • Synthetic biology approaches:

    • CrcB-based biosensors for fluoride detection

    • Minimal synthetic cells with engineered fluoride transport

    • Orthogonal expression systems for controlled CrcB studies

These technologies can be integrated with established approaches for studying plasmid-encoded gene regulation in E. coli O139:H28, potentially revealing interactions between chromosomal CrcB and plasmid-encoded functions .

How can systems biology approaches be applied to understand CrcB's role within the broader context of E. coli O139:H28 pathogenicity?

Systems biology approaches for contextualizing CrcB function:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Develop network models of CrcB-associated pathways

    • Identify condition-specific regulatory networks

  • Genome-scale modeling:

    • Incorporate CrcB function into constraint-based metabolic models

    • Simulate effects of crcB deletion on cellular physiology

    • Predict condition-specific phenotypes

  • Network analysis methods:

    • Construct protein-protein interaction networks

    • Identify functional modules associated with CrcB

    • Apply graph theory to predict critical nodes

  • Comparative genomics frameworks:

    • Analyze CrcB conservation across pathogenic E. coli strains

    • Compare genomic context of crcB across different serotypes

    • Identify serotype-specific regulatory elements

  • Integration with virulence mechanisms:

    • Correlate CrcB activity with virulence factor expression

    • Assess the impact of environmental signals on both systems

    • Develop multi-scale models spanning molecular to host-pathogen interactions

These approaches should consider the serotype-specific characteristics of E. coli O139:H28, including its plasmid-encoded virulence factors and regulatory systems, which may interact with CrcB function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.