Recombinant Escherichia coli O139:H28 Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Escherichia coli O139:H28 Rhomboid protease GlpG (glpG) is a membrane-embedded serine protease belonging to the rhomboid family, which catalyzes intramembrane proteolysis. This enzyme is engineered through recombinant DNA technology for research applications, enabling studies on its structure, catalytic mechanism, and biological roles in bacterial physiology . GlpG is widely studied for its unique ability to cleave transmembrane substrates, making it a critical tool for understanding intramembrane proteolysis .

Enzymatic Mechanism

GlpG operates via a serine protease mechanism:

  • Catalytic Dyad: Ser-201 and His-254 facilitate nucleophilic attack on substrate peptide bonds .

  • Substrate Recognition: Targets transmembrane domains (TMDs) with helix-destabilizing residues (e.g., proline) . Cleavage occurs at hydrophilic juxtamembrane regions, such as between Ser and Asp residues .

  • Activity Assays: Validated using model substrates (e.g., Bla-LY2-MBP) in vitro and in vivo .

Biological Functions

GlpG plays multifaceted roles in bacterial physiology:

  • Membrane Protein Quality Control: Degrades orphan subunits of respiratory complexes (e.g., HybA of hydrogenase-2) to prevent cytotoxic accumulation .

  • Gut Colonization: Promotes persistence of extraintestinal pathogenic E. coli (ExPEC) in the mammalian gut by supporting fatty acid β-oxidation .

  • Regulated Intramembrane Proteolysis (RIP): Processes substrates like Gurken (GknTM) in Drosophila, highlighting evolutionary conservation .

Recombinant Production and Applications

Recombinant GlpG is produced in heterologous systems for biochemical and structural studies:

  • Expression Systems: Optimized in E. coli for high yield (~1.0 mg/mL) .

  • Applications:

    • Structural Studies: Crystallography and NMR to probe active-site dynamics .

    • Enzyme Kinetics: Testing inhibitors like 3,4-dichloroisocoumarin .

    • Substrate Profiling: Identifying cleavage motifs using synthetic transmembrane peptides .

Future Directions

Ongoing research aims to:

  • Engineer GlpG variants with altered substrate specificity for biotechnological applications.

  • Explore its role in bacterial pathogenesis and antibiotic resistance .

  • Develop inhibitors targeting its active site for therapeutic intervention .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
glpG; EcE24377A_3900; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Escherichia coli O139:H28 (strain E24377A / ETEC)
Target Names
glpG
Target Protein Sequence
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPA DPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVVMIACVVVFIAMQILGDQEVM LWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK
Uniprot No.

Target Background

Function

Rhomboid-type serine protease that catalyzes intramembrane proteolysis.

Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rhomboid protease glpG and what is its significance in E. coli?

Rhomboid protease glpG is an intramembrane serine protease (EC 3.4.21.105) that functions within the membrane environment of Escherichia coli. The protein is part of the rhomboid family of proteases that catalyze proteolytic cleavages within the membrane. In E. coli O139:H28, glpG plays a critical role in several biological processes, including glycerol metabolism regulation and bacterial persistence in host environments . Research has shown that glpG has significant impacts on ExPEC (Extraintestinal pathogenic E. coli) survival in the mammalian gastrointestinal tract, highlighting its importance in bacterial pathogenesis and colonization mechanisms .

What are the structural characteristics of recombinant E. coli O139:H28 glpG?

Recombinant E. coli O139:H28 Rhomboid protease glpG is typically produced as a full-length protein containing 276 amino acids. The amino acid sequence begins with mLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPA and continues through a series of hydrophobic and hydrophilic residues that create its characteristic membrane-spanning regions . The protein displays a modular functional architecture that influences its folding pathways and functional states. This modular structure is particularly important for its activity as an intramembrane protease, allowing it to access and cleave substrate proteins within the lipid bilayer environment . The protein is identified in UniProt as A7ZSV4, and structural studies reveal multiple transmembrane domains that position the catalytic residues appropriately within the membrane .

How does glpG relate to glycerol metabolism in E. coli?

GlpG is part of the glycerol metabolism regulatory network in E. coli. Research has shown that disruption of glpG affects the downstream gene glpR, which encodes a transcriptional repressor of factors involved in glycerol degradation . This relationship creates a regulatory connection between membrane proteolysis and central metabolism. Mutation studies demonstrate that disruption of either glpG or glpR impairs E. coli growth in environments where alternate carbon sources such as long-chain fatty acids (like oleate) are the primary nutrients available . This indicates that glpG indirectly influences the bacterial cell's ability to utilize different carbon sources through its effects on metabolic regulation.

What are the folding dynamics of glpG and how do they differ in membrane versus detergent environments?

The folding of glpG presents a fascinating case study in membrane protein dynamics. Computational models reveal significant differences in folding pathways depending on the environment. In detergent micelles, glpG exhibits a phenomenon called "backtracking," where local unfolding of previously folded substructures occurs along the minimum free-energy pathway toward the native state . This backtracking is a direct consequence of the large entropic cost associated with organizing helical bundles without the constraining influence of a lipid bilayer .

In contrast, when folding within a membrane environment (which better represents glpG's natural context), the topological constraints imposed by the bilayer eliminate this backtracking behavior . This environmental dependence explains the experimental observation that certain thermodynamically destabilizing mutations can paradoxically accelerate glpG folding in detergent micelles . The membrane effectively pre-organizes the topology of glpG, reducing the conformational search space and guiding the protein toward its native structure through more direct folding pathways.

How does the modular architecture of glpG influence its folding and function?

GlpG possesses a modular functional architecture that fundamentally shapes both its folding landscape and functional capabilities. Computational analysis using structure-based models reveals that this modularity leads to multiple possible folding pathways rather than a single defined route to the native state . Each module can fold somewhat independently, creating a complex energy landscape with various intermediates.

This modularity also enables glpG to populate near-native states that retain functional significance . These states may represent conformational subtypes that are important for substrate recognition, catalysis, or regulation. The multi-pathway folding behavior is an intrinsic property of glpG's architecture rather than an artifact of experimental conditions, as demonstrated by simulation studies both with and without implicit membrane models . This architectural feature likely evolved to balance the competing demands of efficient folding and functional flexibility within the challenging environment of the lipid bilayer.

What role does glpG play in ExPEC persistence in the mammalian gut?

Research using transposon sequencing (Tn-seq) has identified glpG as a critical factor for ExPEC fitness within intestinal mucus, which serves as a primary nutrient source for E. coli in the gut . When glpG is disrupted, ExPEC shows significantly reduced survival in mouse gut colonization models - by day 14, mutant bacterial numbers were reduced more than 120-fold relative to wild-type strains . This dramatic impact on persistence exceeds that observed for other metabolic genes like fadL and fbp, highlighting glpG's particular importance.

What are the optimal conditions for expressing and purifying recombinant E. coli O139:H28 glpG?

The expression and purification of recombinant E. coli O139:H28 glpG requires careful attention to membrane protein handling. Based on established protocols for similar rhomboid proteases, the recommended approach includes:

  • Expression system selection: E. coli BL21(DE3) strains typically provide high yields for homologous proteins. For challenging constructs, C41(DE3) or C43(DE3) strains designed for membrane protein expression may be preferable.

  • Induction conditions: Lower induction temperatures (16-20°C) with reduced IPTG concentrations (0.1-0.5 mM) often improve folding and reduce aggregation.

  • Membrane extraction: Gentle solubilization using mild detergents such as n-Dodecyl β-D-maltoside (DDM) or LMNG at concentrations just above their critical micelle concentration preserves structural integrity.

  • Purification strategy: Affinity chromatography using appropriate tags (His, FLAG, etc.) followed by size exclusion chromatography yields high purity protein. The tag type should be determined during the production process to optimize for each specific construct .

  • Storage conditions: Once purified, the protein should be stored in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage. Working aliquots can be maintained at 4°C for up to one week to avoid freeze-thaw cycles .

Protein quality should be assessed via SDS-PAGE, Western blotting, and activity assays before proceeding to experimental applications.

How can molecular dynamics simulations be effectively used to study glpG folding mechanisms?

Molecular dynamics simulations provide valuable insights into glpG folding that are difficult to obtain experimentally. Based on published methodologies, the optimal approach includes:

  • Model selection: Coarse-grained structure-based models based on crystal structures (such as PDB ID 2XOV) provide computationally efficient simulation while capturing essential folding dynamics .

  • Membrane representation: Parallel simulations should be conducted with and without implicit membrane models to distinguish environment-dependent folding behaviors . The implicit membrane model establishes distinct energetic parameters for intramembrane versus extramembrane residues.

  • Sampling approach: Multiple temperatures above and below the folding temperature should be sampled, with umbrella sampling at each temperature to access a wide range of folded, partially folded, and unfolded structures .

  • Analysis methods: The Multistate Bennett Acceptance Ratio (MBAR) method can reconstruct unbiased free-energy profiles, compute expectation values of structural order parameters, and perform perturbative calculations to test the effect of small changes to the Hamiltonian .

  • Validation strategy: Computational predictions should be verified against experimental measurements such as folding rates, stability changes upon mutation, and spectroscopic observations of folding intermediates.

This approach has successfully revealed critical insights about backtracking phenomena and the differential effects of destabilizing mutations in membrane versus detergent environments .

How should researchers interpret contradictory results between in vitro and in vivo studies of glpG function?

When facing contradictory results between in vitro and in vivo studies of glpG function, researchers should consider several factors that might explain these discrepancies:

  • Environmental differences: The membranous environment significantly impacts glpG folding and function. In vitro studies using detergent micelles may show different results than those in lipid bilayers or in vivo contexts . For example, mutations that accelerate folding in detergent may have different effects in membrane environments.

  • Functional redundancy: E. coli possesses multiple systems for adapting to metabolic challenges. The relatively modest effect of some glpG-related mutations in vivo might reflect compensatory mechanisms that are absent in controlled in vitro conditions .

  • Polar effects on gene expression: As observed with glpG mutations affecting glpR expression, genetic modifications may have downstream consequences beyond the target gene . Researchers should design complementation experiments to distinguish direct from indirect effects:

Experimental ConditionGrowth in Mucus (CI at 24h)Growth on OleateGrowth on Glucose
ΔglpG + empty vector-0.4PoorNormal
ΔglpG + glpEGR plasmidImprovedRescuedNormal
ΔglpG + glpEG plasmidWorsenedPoorNormal

These results demonstrate that complete complementation requires the entire glpEGR operon, suggesting complex regulatory interactions .

  • Context-dependent function: The significance of glpG may vary with specific environmental conditions. For example, while ΔfadL and Δfbp mutations showed similar defects to ΔglpG in vitro, only ΔglpG exhibited significant colonization defects in mouse gut models .

To resolve contradictions, researchers should design experiments that systematically bridge the gap between in vitro and in vivo conditions, perhaps using more complex membrane mimetics or organoid cultures as intermediate models.

What experimental controls are essential when studying the effects of glpG mutations?

When studying the effects of glpG mutations, several essential controls must be incorporated to ensure valid interpretations:

  • Complementation controls:

    • Include the wild-type gene expressed from a plasmid to confirm phenotype restoration

    • Test both full operon (glpEGR) and partial operon (glpEG) complementation to identify polar effects

    • Use site-directed mutagenesis to distinguish catalytic function from structural roles

  • Growth medium controls:

    • Compare growth on different carbon sources (e.g., glucose vs. oleate) to isolate metabolic effects

    • Include rich and minimal media conditions to assess general fitness versus specific metabolic defects

  • Mutation specificity controls:

    • Create catalytically inactive mutants (e.g., active site serine mutations) to distinguish enzymatic from structural effects

    • Generate truncation variants to map functional domains

    • Create polar and non-polar deletion constructs to separate glpG effects from downstream gene effects

  • Environmental condition controls:

    • Test both detergent-solubilized and membrane-reconstituted proteins for in vitro assays

    • Vary temperature, pH, and ionic conditions to identify condition-dependent phenotypes

    • Include competitive and non-competitive growth assays to detect subtle fitness differences

  • Strain background controls:

    • Introduce identical mutations in multiple E. coli strains (pathogenic and non-pathogenic)

    • Use closely related species to assess evolutionary conservation of function

These controls help distinguish direct from indirect effects, separate glpG-specific functions from general metabolic disruptions, and ensure phenotypes are genuinely attributable to the intended genetic modifications.

How might understanding glpG function contribute to novel antimicrobial strategies?

The critical role of glpG in ExPEC persistence in the mammalian gut suggests several promising avenues for antimicrobial development:

  • Colonization prevention: Since glpG disruption reduces ExPEC gut colonization by more than 120-fold in mouse models , inhibitors targeting glpG could potentially prevent the intestinal reservoir establishment that precedes extraintestinal infections such as urinary tract infections and sepsis.

  • Metabolic vulnerability targeting: GlpG's connection to fatty acid metabolism and glycerol degradation pathways reveals metabolic dependencies that could be exploited. Compounds that mimic the effects of glpG mutation might force pathogens into metabolic states poorly suited for intestinal survival .

  • Selective targeting potential: The apparent species and strain-specific importance of glpG offers the possibility of developing narrow-spectrum antimicrobials that disrupt pathogenic E. coli while preserving beneficial microbiota.

  • Combination therapy approaches: GlpG inhibitors could potentially sensitize pathogens to existing antibiotics by disrupting metabolic adaptation mechanisms, allowing for lower doses or resensitization to previously ineffective compounds.

  • Anti-virulence strategy: Rather than killing bacteria directly, glpG-targeting compounds might reduce pathogenicity by interfering with the metabolic adaptations required for successful host colonization, potentially reducing selection pressure for resistance.

Developing these approaches requires further research into glpG's precise catalytic mechanisms, natural substrates, and structural features unique to pathogenic strains.

What computational approaches show promise for predicting the effects of glpG mutations?

Advanced computational methods offer valuable tools for predicting the effects of glpG mutations on protein stability, function, and folding:

  • Machine learning approaches: Recent advances in machine learning for protein engineering demonstrate that sophisticated models can be trained using limited pre-existing datasets to predict the effects of novel variations . Similar approaches could be applied to glpG to predict mutation effects on stability and function.

  • Structure-based models: Coarse-grained molecular dynamics simulations using structure-based models have successfully revealed complex folding behaviors in glpG, including backtracking phenomena and the differential effects of mutations in different environments . These models can be extended to predict the impact of specific mutations on folding pathways and stability.

  • Integrative prediction frameworks: Combining multiple computational methods—including homology modeling, molecular dynamics, and machine learning—provides more robust predictions than any single approach. For membrane proteins like glpG, specialized methods that account for the lipid bilayer environment are particularly important.

  • Evolutionary coupling analysis: Methods that detect co-evolving residues across multiple sequence alignments can identify functionally important interactions within glpG, helping predict which mutations might disrupt critical networks.

  • Free energy perturbation methods: For detailed energetic predictions, free energy perturbation calculations can estimate the precise thermodynamic impact of mutations on stability and binding interactions.

These computational approaches can guide experimental design by prioritizing the most informative mutations for laboratory testing, potentially accelerating the pace of discovery and reducing resource requirements.

What are the most significant unresolved questions about glpG function?

Despite substantial progress in understanding glpG, several crucial questions remain unresolved:

  • Natural substrates: The physiological substrates of glpG in E. coli remain largely unidentified. While its proteolytic activity is established, the specific proteins it cleaves under natural conditions and how this relates to its role in bacterial persistence are unknown.

  • Regulatory mechanisms: How glpG activity is regulated in response to changing environmental conditions remains poorly understood. Are there allosteric regulators, post-translational modifications, or protein-protein interactions that modulate its function?

  • Structural dynamics during catalysis: The conformational changes that occur during substrate binding and catalysis have not been fully characterized, particularly in the context of the native membrane environment.

  • Species-specific functions: Whether glpG serves different roles across various E. coli strains and related bacterial species remains unclear. The dramatic effect of glpG disruption on pathogenic strain gut colonization raises questions about potential pathogen-specific adaptations.

  • Connection to stress responses: The relationship between glpG function and bacterial stress response systems, particularly those activated during host colonization, warrants further investigation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.