Recombinant Escherichia coli O139:H28 Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your requirements.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
mdtJ; EcE24377A_1807; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Escherichia coli O139:H28 (strain E24377A / ETEC)
Target Names
mdtJ
Target Protein Sequence
MYIYWILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVKKIALGVA YALWEGIGILFITLFSVLLFDESLSLMKIAGLTTLVAGIVLIKSGTRKARKPELEVNHGA V
Uniprot No.

Target Background

Function

Function: Catalyzes the excretion of spermidine.

Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the MdtJ protein and what is its primary function in E. coli?

MdtJ is a membrane protein that belongs to the small multidrug resistance (SMR) family of drug exporters in Escherichia coli. Its primary function is to work in conjunction with MdtI to form the MdtJI complex, which catalyzes the excretion of spermidine from bacterial cells. This function is particularly important for maintaining polyamine homeostasis, as polyamines like spermidine are essential for normal cell growth but can become toxic when they accumulate to excessive levels. The MdtJI complex provides a mechanism for the cell to regulate internal spermidine concentrations, protecting against toxicity while maintaining necessary levels for cellular processes .

Why must MdtJ work with MdtI rather than functioning independently?

Experimental evidence demonstrates that both MdtJ and MdtI proteins are required for functional spermidine excretion. When either protein was expressed alone in E. coli strains sensitive to spermidine toxicity (such as CAG2242, which is deficient in spermidine acetyltransferase), no significant protection against spermidine-induced cell death was observed. Only when both proteins were co-expressed did the cells show increased viability in the presence of high spermidine concentrations. This indicates that MdtJ and MdtI form a functional heteromeric complex where both components are necessary for proper activity. The coordinated expression of both genes is supported by the observation that mdtJ and mdtI are naturally co-expressed in E. coli .

How can researchers experimentally verify MdtJ function in laboratory settings?

Researchers can verify MdtJ function through multiple complementary approaches:

  • Viability assays: Transform strains deficient in spermidine metabolism (e.g., E. coli CAG2242) with plasmids expressing MdtJ and/or MdtI, then challenge with toxic levels of exogenous spermidine (2-12 mM). Measure cell viability through colony counting methods.

  • Polyamine content analysis: Quantify intracellular spermidine and putrescine levels in cells with and without MdtJI expression when cultured in spermidine-containing media.

  • Radiolabeled spermidine excretion assays: Load cells with [14C]spermidine, then measure the rate of excretion by tracking radioactivity in the extracellular medium over time.

  • Site-directed mutagenesis: Create targeted mutations in key amino acid residues suspected to be involved in transport activity, then assess the impact on spermidine excretion function .

Which specific amino acid residues are critical for MdtJ function, and how should mutations be designed to study them?

Multiple amino acid residues have been identified as crucial for MdtJ function in the spermidine excretion complex. The following table summarizes the key residues and their significance:

ProteinCritical ResiduesPotential Role
MdtJTyr4, Trp5, Glu15, Tyr45, Tyr61, Glu82Involved in substrate recognition and transport activity
MdtIGlu5, Glu19, Asp60, Trp68, Trp81Involved in substrate recognition and transport activity

To effectively study these residues, researchers should:

  • Design alanine-scanning mutagenesis experiments targeting each residue individually

  • Create charge-reversal mutations for acidic residues (Glu→Lys) to test electrostatic interactions

  • Replace aromatic residues with non-aromatic ones of similar size to distinguish between steric and π-interaction effects

  • Test the mutants using the functional assays described earlier to quantify the impact on spermidine excretion activity

What experimental design is most appropriate for studying MdtJ regulation in response to polyamine stress?

For studying MdtJ regulation under polyamine stress, a randomized complete block design (RCBD) is recommended to control for experimental variation. The statistical model would be:

yij = μ + τi + βj + εij

Where:

This design enables researchers to focus on treatment effects while controlling for batch-to-batch variation. The analysis would employ ANOVA with MStr/MSE as the test statistic to determine significance of the treatment effects .

For MdtJ specifically, treatments should include:

  • Control (no added spermidine)

  • Sub-physiological spermidine concentrations (0.5-1 mM)

  • Physiological spermidine concentrations (1-2 mM)

  • Supra-physiological spermidine concentrations (>2 mM)

Measure mdtJI mRNA levels using qRT-PCR at multiple time points after exposure to identify both acute and adaptive responses .

How does spermidine regulate MdtJI expression at the molecular level?

The expression of mdtJI is increased in response to elevated spermidine levels, suggesting a regulatory feedback mechanism. While the precise molecular mechanism is not fully elucidated, research indicates that spermidine may function as a signaling molecule that triggers a transcriptional response.

To investigate this regulatory pathway, researchers should:

  • Analyze the promoter region of the mdtJI operon for potential binding sites of known transcription factors

  • Perform chromatin immunoprecipitation (ChIP) experiments to identify proteins that bind to the mdtJI promoter under different spermidine conditions

  • Create reporter gene constructs with the mdtJI promoter fused to a measurable reporter (e.g., luciferase) to quantify transcriptional activity

  • Employ gene knockout approaches to systematically test candidate regulatory proteins

Based on the available data, spermidine appears to influence mdtJI transcription, resulting in increased expression of the transport complex when spermidine levels are elevated, creating a feedback loop that helps maintain polyamine homeostasis .

What methodological considerations are important when assessing MdtJ-mediated spermidine transport kinetics?

When studying MdtJ-mediated spermidine transport kinetics, researchers should account for several methodological considerations:

  • Membrane protein reconstitution: As membrane proteins, MdtJ and MdtI must be properly expressed, isolated, and reconstituted into artificial membrane systems (liposomes or proteoliposomes) to accurately measure their transport activity in vitro.

  • Transport assay design: Implement both influx and efflux assays using radiolabeled spermidine to determine directional preferences and energy requirements.

  • Competitive inhibition studies: Include structurally similar polyamines (putrescine, spermine) to assess substrate specificity of the MdtJI complex.

  • Energy coupling mechanism: Determine whether spermidine transport is driven by proton motive force, ATP hydrolysis, or another energy source by systematically disrupting each potential energy source.

  • Statistical analysis: Apply appropriate statistical models such as one-way ANOVA for comparing transport rates under different conditions, with careful consideration of experimental blocking factors to minimize technical variation .

How does the MdtJI complex compare with other polyamine transport systems in bacteria?

The MdtJI complex represents one of several polyamine transport systems identified in bacteria, but with distinct characteristics. Unlike previously characterized polyamine importers, MdtJI specifically functions in polyamine export.

Researchers investigating comparative aspects should:

  • Conduct parallel experiments with other polyamine transporters using identical experimental conditions

  • Compare substrate specificity profiles across different transport systems

  • Analyze protein sequence and structural homology between MdtJ/MdtI and other transporters

  • Examine evolutionary relationships between polyamine transport systems across bacterial species

This comparative approach may reveal convergent or divergent evolutionary solutions to polyamine homeostasis in bacteria and identify conserved functional motifs that are essential for transport activity .

What techniques can overcome challenges in studying membrane proteins like MdtJ?

Membrane proteins such as MdtJ present unique experimental challenges due to their hydrophobicity and requirements for a lipid environment. Researchers can address these challenges through:

  • Optimized expression systems: Use specialized expression vectors with appropriate promoters and fusion tags that enhance membrane protein production without toxicity.

  • Epitope tagging strategies: Implement techniques like that described in the search results, where researchers used an HA3 tag fusion with MdtJ by "inserting the mdtJ gene, containing the promoter region and the open reading frame lacking the termination codon" into a plasmid vector to create a fusion protein for detection and purification purposes .

  • Detergent screening: Systematically test different detergents for efficient solubilization while maintaining protein structure and function.

  • Nanodiscs and liposome reconstitution: Employ these artificial membrane systems to study MdtJ in a native-like environment.

  • Advanced structural biology techniques: Utilize cryo-electron microscopy or X-ray crystallography optimized for membrane proteins to determine the three-dimensional structure of the MdtJI complex.

Each of these approaches requires careful optimization and validation to ensure that the experimental system accurately reflects the native function of MdtJ in bacterial cells .

How should researchers analyze spermidine excretion data to account for experimental variability?

When analyzing spermidine excretion data, researchers should implement rigorous statistical approaches to account for experimental variability:

  • Appropriate experimental design: Implement randomized complete block design (RCBD) where treatments (e.g., different MdtJ variants) are randomly assigned within blocks (e.g., experimental batches or days).

  • Statistical model application: Use the model yij = μ + τi + βj + εij as described earlier, where treatment effects (τi) can be tested against error variance using ANOVA.

  • Transformation of data: If necessary, transform data (log, square root) to meet the assumptions of normality and homoscedasticity required for parametric tests.

  • Multiple comparisons: When comparing multiple MdtJ variants or conditions, employ appropriate post-hoc tests (e.g., Tukey's HSD) to control for family-wise error rates.

  • Effect size reporting: Beyond p-values, report effect sizes and confidence intervals to communicate the magnitude and precision of observed differences in spermidine excretion rates .

What controls are essential for validating MdtJ function in heterologous expression systems?

  • Empty vector control: Cells transformed with the expression vector lacking the mdtJ gene to account for vector-specific effects.

  • Single protein controls: Express MdtJ and MdtI individually to demonstrate their interdependence, as research has shown neither protein alone confers significant spermidine resistance.

  • Inactive mutant control: Express a non-functional MdtJ variant (e.g., with mutations in critical residues like Tyr4, Trp5, or Glu15) as a negative control.

  • Complementation control: Reintroduce wild-type MdtJ into knockout strains to confirm that observed phenotypes are specifically due to MdtJ loss.

  • Expression level verification: Quantify protein expression levels using Western blotting to ensure that functional differences are not simply due to expression differences.

These controls are essential for attributing observed phenotypes specifically to MdtJ function rather than experimental artifacts or secondary effects .

How might MdtJ research contribute to understanding bacterial stress responses?

Research on MdtJ contributes to our understanding of bacterial stress responses in several important ways:

  • Polyamine stress adaptation: MdtJ demonstrates how bacteria have evolved specific mechanisms to maintain polyamine homeostasis under stress conditions.

  • Membrane transporter regulation: The regulation of mdtJI expression by spermidine levels provides insight into how bacteria sense and respond to changes in their internal chemical environment.

  • Stress response networks: MdtJ function likely intersects with broader stress response networks, potentially connecting polyamine metabolism with other cellular stress adaptation mechanisms.

  • Evolution of detoxification systems: Studying the MdtJI complex adds to our understanding of how bacteria evolve specialized detoxification systems for compounds that are both essential and potentially toxic.

Future research should focus on integrating MdtJ function into the broader context of bacterial stress physiology, potentially revealing new therapeutic targets or biotechnological applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.