Recombinant Escherichia coli O139:H28 Universal stress protein B (uspB)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

Recombinant Escherichia coli O139:H28 Universal Stress Protein B (uspB) is a genetically engineered protein expressed in E. coli systems to study bacterial stress response mechanisms. This 14-kDa protein (111 amino acids) is encoded by the uspB gene and belongs to the RpoS regulon, which governs stationary-phase resistance in E. coli . Its recombinant form is typically fused with an N-terminal His tag for purification and detection purposes .

Key Properties

PropertyDetail
Molecular Weight~14 kDa
Amino Acid SequenceMISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQVRLVWYIYAQRYRDHHDDEFIRRCER...
Expression HostE. coli
TagN-terminal His tag
StorageLyophilized powder at -20°C/-80°C; Tris/PBS buffer with 6% trehalose (pH 8.0)

Functional Roles

  • Ethanol Resistance: UspB mutants exhibit heightened sensitivity to ethanol during stationary phase, implicating its role in ethanol stress adaptation .

  • Regulation: Expression is strictly dependent on the sigma factor RpoS (σ<sup>S</sup>) and modulated by H-NS, linking it to broader stress-response networks .

  • Membrane Localization: Its membrane association suggests potential roles in maintaining membrane integrity under stress .

Genetic and Regulatory Mechanisms

  • Promoter Region: The uspB promoter contains a σ<sup>S</sup>-binding site (-10 sequence: CTATACT) and upstream DNA curvature, typical of RpoS-dependent genes .

  • Transcriptional Control:

    • Induced ~50-fold during stationary phase in nutrient-rich media (e.g., LB broth) .

    • Regulatory crosstalk with uspA, though uspB is not part of the core usp gene family in E. coli .

Key Research Findings

  • Ethanol Sensitivity: Deletion of uspB reduces survival in ethanol-exposed stationary-phase cells by disrupting membrane stability .

  • Evolutionary Conservation: UspB shares 86% amino acid identity with a homolog in Yersinia pestis, indicating conserved stress-response roles in Enterobacteriaceae .

  • Regulatory Mutants: Overexpression of UspB induces cell death in stationary phase, highlighting dosage-dependent toxicity .

Comparative Analysis with Other USPs

FeatureUspB (O139:H28)UspAUspD
LocalizationMembraneCytoplasmicCytoplasmic
Stress ResistanceEthanolOxidative, heatIron homeostasis
RegulationRpoS-dependentRpoS-independentRpoS-dependent
Structural MotifsTransmembrane domainsATP-binding domainATP-binding domain

Challenges and Future Directions

  • Functional Redundancy: Overlap with other USPs (e.g., UspA, UspD) complicates phenotype isolation .

  • Structural Studies: Limited high-resolution data on UspB’s membrane topology .

  • Therapeutic Potential: Preliminary vaccine studies focus on its role in pathogenic E. coli strains (e.g., ETEC) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of the product is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
uspB; EcE24377A_3976; Universal stress protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Escherichia coli O139:H28 (strain E24377A / ETEC)
Target Names
uspB
Target Protein Sequence
MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQV RLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH
Uniprot No.

Target Background

Database Links
Protein Families
Universal stress protein B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How should researchers distinguish uspB from other Universal stress proteins in experimental design?

When designing experiments to study uspB specifically:

  • Genetic verification: Confirm target specificity by sequencing the uspB gene (Uniprot accession: A7ZT30) in your E. coli O139:H28 strain .

  • Structural differentiation: Unlike UspEG-type proteins that contain the ATP-binding motif [G-2X-G-9X-(S/T)], uspB belongs to the UspA-like group lacking this motif. Verify this through structural analysis to ensure specificity .

  • Expression profiling: Design comparative experiments that monitor expression of multiple USP family members simultaneously under identical conditions to establish uspB-specific response patterns.

  • Knockout comparison: Create uspB knockout strains alongside knockouts of other USP family members to differentiate their functional roles through phenotypic analysis.

The experimental approach should address potential redundancy in function, as bacteria typically possess multiple USP paralogs with potentially overlapping functions .

What experimental methods are recommended for purifying recombinant uspB for functional studies?

For obtaining high-quality recombinant uspB:

  • Expression system selection:

    • Use a compatible expression strain (BL21(DE3) or similar) with codon optimization for E. coli O139:H28 proteins

    • Consider a fusion tag system (His-tag, GST, or MBP) for simplified purification

  • Purification protocol:

    • Initial capture: Affinity chromatography using the appropriate resin for your chosen tag

    • Intermediate purification: Ion exchange chromatography based on uspB's theoretical pI

    • Polishing: Size exclusion chromatography to ensure homogeneity

    • Tag removal: If applicable, using appropriate proteases followed by a second affinity step

  • Storage optimization:

    • Based on stability data for similar proteins, store in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage

    • Avoid repeated freeze-thaw cycles, and prepare working aliquots for 4°C storage of up to one week

  • Quality control:

    • SDS-PAGE and Western blot to confirm identity and purity

    • Mass spectrometry to verify molecular weight

    • Circular dichroism to assess proper folding

These methodological steps ensure reproducibility in downstream functional assays.

What experimental designs effectively elucidate uspB's role in stress response pathways?

Advanced experimental designs to investigate uspB's role in stress response pathways should incorporate:

  • Time-course expression analysis:

    • Design: Monitor uspB expression across multiple time points (0, 15, 30, 60, 120, 240 min) after stress induction

    • Methodology: Combine qRT-PCR for mRNA levels with Western blotting for protein quantification

    • Analysis: Apply time-series statistics to identify expression patterns and activation thresholds

  • Stress condition matrix experiments:

    Stress ConditionDurationTemperatureMeasurement Method
    Nutrient starvation0-24h37°CRNA-seq + Proteomics
    Oxidative stress0-6h37°CRNA-seq + Proteomics
    Heat shock0-2h42°CRNA-seq + Proteomics
    Cold shock0-6h16°CRNA-seq + Proteomics
    Combined stressesVariableVariableRNA-seq + Proteomics
  • Interactomics approach:

    • CRISPR-Cas9 mediated tagging of endogenous uspB

    • Chromatin immunoprecipitation (ChIP) to identify DNA-binding activity

    • Co-immunoprecipitation coupled with mass spectrometry to identify protein interaction partners

    • Yeast two-hybrid or bacterial two-hybrid screening for direct interaction partners

  • Systems biology integration:

    • Correlation of uspB expression data with global transcriptomic and proteomic changes

    • Network analysis to position uspB within stress response signaling pathways

    • Mathematical modeling of uspB kinetics in response to varying stress intensities

These approaches should be implemented with appropriate controls and replication to ensure statistical validity of the findings.

How can researchers address data inconsistencies in uspB expression studies under different stress conditions?

Methodologies to resolve data contradictions in uspB expression studies:

  • Standardization of experimental conditions:

    • Establish precise definitions for stress intensity (e.g., exact molar concentrations of stressors)

    • Standardize growth media composition and preparation protocols

    • Define consistent time points and sampling procedures

    • Implement identical analytical methods across laboratories

  • Multi-omics data integration framework:

    • Correlate transcriptomic (mRNA) data with proteomic measurements to identify post-transcriptional regulation

    • Include metabolomic analysis to connect uspB expression with metabolic state changes

    • Develop computational models that account for data from multiple platforms

  • Statistical approach for contradictory data analysis:

    • Meta-analysis of published expression data using random-effects models

    • Hierarchical Bayesian modeling to account for lab-to-lab variability

    • Sensitivity analysis to identify experimental parameters that most significantly affect results

  • Validation through orthogonal methods:

    • Confirm RNA-seq findings with qRT-PCR

    • Validate proteomics results with targeted Western blotting

    • Cross-verify functional outcomes through phenotypic assays

  • Experimental design improvements:

    • Include detailed reporting of all experimental variables following MIAME/MINSEQE guidelines

    • Implement factorial experimental designs to identify interaction effects between stressors

    • Conduct dose-response studies to establish thresholds for uspB activation

This systematic approach helps reconcile conflicting findings and establishes a more coherent understanding of uspB regulation.

What are the optimal methodological approaches for studying differential regulation between uspB and other USP family members?

To investigate the differential regulation of uspB compared to other USP family members:

  • Comparative promoter analysis workflow:

    • In silico identification of transcription factor binding sites in promoter regions of all USP genes

    • Reporter gene constructs (GFP, luciferase) under control of different USP promoters

    • Site-directed mutagenesis of predicted regulatory elements to confirm functionality

    • ChIP-seq to identify transcription factors binding to uspB promoter versus other USP promoters

  • Post-transcriptional regulation investigation:

    • RNA stability assays comparing mRNA half-lives across USP family

    • Identification of small RNAs regulating USP expression using RNA immunoprecipitation

    • Ribosome profiling to assess translation efficiency differences

  • Epigenetic regulation assessment:

    • Methylation analysis of promoter regions across growth phases

    • Histone modification profiling in eukaryotic host interaction models

    • DNA accessibility mapping using ATAC-seq or similar methods

  • Evolutionary approach:

    • Phylogenetic analysis of regulatory regions across bacterial species

    • Comparison of stress responses in related strains with differing USP complements

    • Reconstruction of ancestral sequences to identify evolutionary patterns in regulation

These methodologies should be implemented with careful consideration of biological replicates and appropriate statistical power calculations before beginning experiments .

What advanced techniques can be applied to investigate uspB protein-protein interactions in stress response networks?

Advanced methodologies for studying uspB protein-protein interactions include:

  • Proximity-based interaction mapping:

    • BioID or TurboID approach: Fusion of biotin ligase to uspB to biotinylate nearby proteins

    • APEX2 proximity labeling: Peroxidase-based labeling of proximal proteins

    • Split-protein complementation assays: Monitoring direct interactions through reporter reconstitution

  • Dynamic interaction profiling:

    • FRET/BRET for real-time interaction monitoring in living cells

    • Time-resolved co-immunoprecipitation at defined intervals post-stress

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces and conformational changes

  • Structural characterization of interaction interfaces:

    • Cryo-electron microscopy of uspB-containing complexes

    • X-ray crystallography of co-crystallized interaction partners

    • NMR spectroscopy for dynamic interaction mapping

    • Cross-linking mass spectrometry to identify interaction points

  • Computational prediction and validation workflow:

    • Molecular docking simulations based on known structures

    • Molecular dynamics simulations to assess stability of predicted interactions

    • Machine learning approaches to predict novel interaction partners

    • Experimental validation of predictions using targeted pull-down assays

  • Functional validation methods:

    • Mutational analysis of predicted interaction surfaces

    • Competition assays with peptide mimetics of interaction domains

    • Phenotypic assessment of interaction-deficient mutants under stress conditions

These techniques should be applied with careful consideration of both false positives and false negatives, with appropriate statistical analysis of resulting interaction networks.

How should researchers design experiments to distinguish uspB-specific effects from general stress responses in E. coli?

To isolate uspB-specific effects from general stress responses:

  • Genetic manipulation strategy:

    • Create precise gene deletions (ΔuspB) using CRISPR-Cas9 or recombineering

    • Develop complementation strains with wild-type uspB under native and inducible promoters

    • Generate point mutants in functional domains to separate specific activities

    • Establish dose-dependent expression systems for titrating uspB levels

  • Comparative phenotype analysis:

    StrainSurvival in stressGrowth rate recoveryProtein aggregationMetabolic changes
    Wild-typeBaselineBaselineBaselineBaseline
    ΔuspBMeasure % changeMeasure delayMeasure increaseProfile changes
    ΔuspB + puspBShould restoreShould restoreShould restoreShould restore
    ΔuspB + mutant variantsVaries by mutationVaries by mutationVaries by mutationVaries by mutation
    ΔuspA (control)Different patternDifferent patternDifferent patternDifferent pattern
  • Transcriptional regulon mapping:

    • RNA-seq comparing ΔuspB to wild-type under multiple stress conditions

    • ChIP-seq if uspB has potential DNA-binding activity

    • Identification of genes specifically affected by uspB absence versus general stress genes

  • Temporal resolution approach:

    • High-density time course sampling after stress induction

    • Comparison of immediate (0-30 min), early (30-120 min), and late (2-24h) response genes

    • Correlation of uspB levels with temporal expression patterns

  • Stress-specific marker analysis:

    • Monitor established markers for general stress responses (RpoS regulon, heat shock proteins)

    • Compare activation patterns with and without functional uspB

    • Identify divergence points in signaling pathways

This experimental framework allows researchers to distinguish uspB-specific effects from the broader stress response network with high confidence and reproducibility.

What are the recommended approaches for studying uspB localization and its significance in stress response?

To effectively investigate uspB localization:

  • Fluorescent protein fusion strategy:

    • C-terminal vs. N-terminal GFP/mCherry fusions to determine optimal configuration

    • Verification that fusion proteins retain stress response functionality

    • Live-cell imaging under various stress conditions with time-lapse microscopy

    • Super-resolution techniques (STORM, PALM) for precise subcellular localization

  • Biochemical fractionation approach:

    • Standardized protocol for separating bacterial cell compartments

    • Western blot analysis of fractions using anti-uspB antibodies

    • Mass spectrometry-based proteomics of isolated fractions

    • Comparison of localization patterns before and after stress induction

  • Immunogold electron microscopy workflow:

    • Development of specific antibodies against uspB

    • Optimization of fixation and embedding protocols

    • Quantitative analysis of gold particle distribution

    • 3D tomographic reconstruction for spatial relationships

  • Co-localization studies:

    • Multi-color imaging with markers for specific cellular structures

    • Quantitative co-localization analysis using Pearson's correlation coefficient

    • Förster resonance energy transfer (FRET) to detect proximity to proposed partners

    • Dynamic tracking of localization changes during stress response progression

  • Functional correlation analysis:

    • Correlation between localization patterns and stress resistance phenotypes

    • Mutational analysis of potential localization signals

    • Chemical inhibition of trafficking pathways to assess functional impact

    • Heterologous expression studies to test conservation of localization mechanisms

These methods should be implemented with rigorous controls and statistical analysis to establish the biological significance of observed localization patterns in stress response.

What experimental considerations are critical when comparing uspB function across different bacterial strains?

When conducting comparative uspB studies across bacterial strains:

  • Sequence and structure homology assessment:

    • Comprehensive sequence alignment of uspB homologs across target strains

    • Prediction of structural conservation using molecular modeling

    • Identification of strain-specific variations in functional domains

    • Phylogenetic analysis to establish evolutionary relationships

  • Standardized experimental conditions:

    • Identical growth media and conditions for all strains

    • Normalization methods for differences in growth rates and cell sizes

    • Defined stress parameters applied consistently across strains

    • Appropriate strain-specific controls for each experiment

  • Cross-strain complementation tests:

    • Exchange of uspB genes between strains through genetic engineering

    • Functional assessment of heterologous uspB proteins

    • Identification of strain-specific cofactors or interaction partners

    • Analysis of gene dosage effects across strain backgrounds

  • Comparative omics framework:

    Analysis TypeParameters to CompareNormalization MethodStatistical Approach
    TranscriptomicsExpression patternsTPM/RPKM with spike-insDESeq2/edgeR
    ProteomicsProtein abundanceiBAQ with reference proteinsLIMMA
    MetabolomicsMetabolic shiftsInternal standardsANOVA with FDR
    PhenomicsGrowth/survival metricsStrain-specific baselinesMixed-effects models
  • Host-pathogen interaction considerations:

    • Comparative virulence assays if pathogenic strains are included

    • Host cell response to different bacterial strains

    • uspB contribution to strain-specific host adaptation

    • Cross-species complementation experiments

These methodological considerations ensure valid comparisons of uspB function across strains while accounting for genetic and physiological differences that could confound interpretation.

How can researchers effectively design experiments to study the role of uspB in bacterial persistence and antibiotic tolerance?

To investigate uspB's role in persistence and antibiotic tolerance:

  • Persistence assay optimization:

    • Time-kill curve analysis comparing wild-type and ΔuspB strains

    • Determination of minimum duration for biphasic killing curves

    • Multiple antibiotic classes testing to distinguish general vs. specific mechanisms

    • Regrowth kinetics assessment of surviving persisters

  • Genetic manipulation strategy:

    • Creation of regulated uspB expression constructs (under- and overexpression)

    • Epistasis analysis with known persistence genes (hipA, relA, etc.)

    • Single-cell reporters to monitor uspB expression in persister subpopulations

    • CRISPR interference for temporal uspB downregulation

  • Persister formation conditions matrix:

    ConditionDurationMeasurementAnalysis Method
    Nutrient limitation1-7 daysCFU countingLog-reduction
    Stationary phase1-14 daysFlow cytometryPopulation heterogeneity
    Biofilm growth1-21 daysConfocal microscopySpatial distribution
    Host cell infection1-7 daysGentamicin protectionIntracellular persistence
  • Mechanistic investigation approaches:

    • Metabolic profiling of persister cells with and without uspB

    • Proteomic analysis focusing on stress response and repair systems

    • Transcriptional changes in uspB-dependent persisters

    • Assessment of membrane potential and permeability changes

  • Translational research considerations:

    • Testing clinically relevant antibiotics against uspB-modified strains

    • Combination therapy approaches targeting uspB-dependent mechanisms

    • Development of anti-persister compounds based on uspB pathway insights

    • Host-mimicking stress conditions to simulate in vivo persistence

These experimental approaches should incorporate rigorous statistical analysis and appropriate sample sizes to account for the inherent heterogeneity of persister populations.

What statistical approaches are most appropriate for analyzing uspB expression data across multiple stress conditions?

For robust statistical analysis of uspB expression across multiple stress conditions:

  • Experimental design considerations:

    • Power analysis to determine adequate sample size (minimum n=3, preferably n≥5)

    • Inclusion of technical and biological replicates

    • Randomization of sample processing order to minimize batch effects

    • Appropriate reference genes selection for normalization

  • Normalization strategies:

    • For qRT-PCR: Multiple reference gene normalization using geNorm or NormFinder

    • For RNA-seq: DESeq2 or edgeR normalization with spike-in controls

    • For proteomics: Global normalization with internal standards

    • Batch effect correction using ComBat or similar algorithms

  • Statistical testing framework:

    Analysis GoalRecommended TestAlternative ApproachesPost-hoc Methods
    Two-condition comparisonStudent's t-testMann-Whitney UN/A
    Multiple condition comparisonOne-way ANOVAKruskal-WallisTukey HSD, Dunnett's
    Time series analysisRepeated measures ANOVAMixed effects modelsBonferroni, Sidak
    Multifactorial designTwo-way ANOVAPERMANOVATukey HSD
  • Advanced statistical approaches:

    • Linear mixed-effects models for nested experimental designs

    • Principal component analysis for pattern recognition across conditions

    • Cluster analysis to identify co-regulated genes

    • Bayesian methods for integrating prior knowledge with experimental data

  • Visualization and reporting:

    • Effect size calculation (Cohen's d, fold change) alongside p-values

    • Confidence interval reporting for all measurements

    • Multiple testing correction (Benjamini-Hochberg) for genome-wide studies

    • Standardized visualization formats (box plots with individual data points)

These statistical approaches should be applied with consideration of the experiment's design and biological context, with clear reporting of all statistical parameters .

How should researchers interpret contradictory findings in uspB function between in vitro and in vivo models?

To reconcile uspB functional discrepancies between in vitro and in vivo models:

  • Systematic comparison framework:

    • Parallel analysis using identical strains and genetic constructs

    • Detailed documentation of all environmental parameters in both systems

    • Side-by-side measurement of key stress indicators (oxidative stress, pH, etc.)

    • Temporal profiling to identify potential kinetic differences

  • Model refinement strategy:

    • Development of in vitro conditions that better mimic in vivo microenvironments

    • Creation of intermediate complexity models (ex vivo, organoid, etc.)

    • Identification of host factors potentially affecting uspB function

    • Modification of genetic backgrounds to account for in vivo selective pressures

  • Technical validation approaches:

    • Cross-verification using multiple methodologies for key measurements

    • Independent replication in different laboratories

    • Use of different in vivo models to identify consistent patterns

    • Genetic complementation testing across systems

  • Integrative analysis methods:

    • Systems biology modeling to predict context-dependent behavior

    • Network analysis to identify differing regulatory inputs between systems

    • Meta-analysis of published data to establish patterns of discrepancy

    • Machine learning approaches to identify predictive features for in vivo behavior

  • Interpretation framework:

    • Consideration of biological relevance versus statistical significance

    • Development of unified hypotheses that account for system-specific variables

    • Evaluation of translational implications of discrepancies

    • Design of targeted experiments to directly test hypothesized mechanisms of discrepancy

This methodological approach acknowledges that differences between systems may represent important biological insights rather than experimental artifacts, and should be explored systematically.

What emerging technologies show promise for advancing uspB research and stress response studies?

Emerging technologies with significant potential for uspB research include:

  • Single-cell analysis platforms:

    • Single-cell RNA-seq to identify uspB expression heterogeneity

    • CyTOF mass cytometry for multiparameter single-cell protein analysis

    • Microfluidics for tracking individual cell responses over time

    • Nanopore sequencing for long-read transcriptomics at single-cell resolution

  • Advanced imaging technologies:

    • Lattice light-sheet microscopy for long-term live cell imaging

    • Expansion microscopy for super-resolution imaging of bacterial cells

    • Correlative light and electron microscopy (CLEM) for structural context

    • Label-free imaging methods for non-invasive monitoring

  • Genome editing and synthetic biology tools:

    • CRISPR interference for precise temporal control of uspB expression

    • Base editing for introducing specific amino acid changes

    • Synthetic gene circuits to probe uspB regulation

    • Cell-free expression systems for rapid functional testing

  • Computational and AI approaches:

    • Deep learning for predicting stress response patterns

    • Molecular dynamics simulations of uspB conformational changes

    • Network inference algorithms for mapping stress response pathways

    • Automated high-throughput data analysis pipelines

  • Novel biochemical techniques:

    • Protein painting for mapping interaction surfaces

    • Cross-linking mass spectrometry for in vivo interaction studies

    • Time-resolved structural methods (TR-XFELs)

    • Metabolic labeling strategies for tracking protein turnover

These technologies should be implemented with careful experimental design and appropriate controls to maximize their impact on understanding uspB function in stress response pathways.

What methodological approaches would best elucidate the evolutionary significance of uspB in bacterial adaptation?

To investigate the evolutionary significance of uspB:

  • Comparative genomics framework:

    • Whole genome sequencing of diverse bacterial isolates

    • Identification of uspB orthologs and paralogs across species

    • Analysis of selection signatures (dN/dS ratios) in uspB sequences

    • Examination of synteny and gene neighborhood conservation

  • Experimental evolution approach:

    • Long-term evolution experiments under various stress conditions

    • Tracking of uspB sequence and expression changes over generations

    • Competitions between ancestral and evolved strains

    • Functional characterization of naturally occurring uspB variants

  • Ancestral reconstruction methods:

    • Phylogenetic inference of ancestral uspB sequences

    • Resurrection and functional testing of ancestral proteins

    • Comparison of ancient and modern uspB stress response capabilities

    • Identification of key mutations in uspB evolutionary history

  • Environmental and clinical isolate analysis:

    • Collection of isolates from diverse ecological niches

    • Stress resistance profiling correlated with uspB sequence variants

    • Horizontal gene transfer assessment for uspB and related genes

    • Population genomics to identify selective sweeps affecting uspB

  • Structural evolution investigation:

    • Comparison of uspB structural features across evolutionary distance

    • Identification of conserved functional domains versus variable regions

    • Molecular dynamics simulations of ancestral and modern proteins

    • Evaluation of evolutionary constraints on protein folding and function

These approaches provide a comprehensive framework for understanding how uspB has evolved to support bacterial stress adaptation across different environmental challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.