Recombinant Escherichia coli O139:H28 UPF0059 membrane protein yebN (yebN)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant YebN is a full-length membrane protein derived from E. coli O139:H28, a pathogenic strain linked to diarrheal diseases . The protein is tagged with a hexahistidine (His) motif at the N-terminus to facilitate purification and detection .

2.1. Membrane Localization

YebN is classified as an inner membrane protein, likely involved in lipid homeostasis and lipopolysaccharide (LPS) synthesis regulation . Studies on homologous proteins (e.g., YejM/PbgA) suggest its role in modulating proteolysis of LpxC, an enzyme critical for LPS biosynthesis .

2.2. Genetic Context in Pathogenicity

YebN is encoded in pathogenic E. coli strains like O139:H28 (ETEC E24377A), which expresses colonization factors CS1 and CS3 . Genomic analyses associate YebN with virulence traits, including iron acquisition and membrane stability in host environments .

3.1. Expression Systems

YebN is produced using plasmid vectors (e.g., pET) in E. coli BL21(DE3), leveraging T7 RNA polymerase (T7 RNAP) for high-yield expression . Key optimizations include:

  • Copy Number Control: Mutations in plasmid origins (e.g., pGRASS ori) enhance yields by reducing RNAI-RNAII interactions .

  • Tag Integration: His tags improve solubility and simplify purification via immobilized metal affinity chromatography (IMAC) .

3.2. Challenges

  • Toxicity: Overexpression of membrane proteins like YebN often disrupts cell growth, necessitating tightly regulated promoters (e.g., T7/ lac hybrids) .

  • Inclusion Bodies: Aggregation-prone proteins require codon optimization or chaperone co-expression .

4.1. Vaccine Development

YebN’s membrane localization makes it a candidate for polyvalent vaccines targeting ETEC. Strain E24377A (O139:H28) has been used in live attenuated vaccine trials, eliciting mucosal immune responses .

4.2. Antibiotic Resistance Studies

YebN homologs (e.g., YejM) regulate LPS synthesis, a pathway linked to outer membrane integrity and intrinsic drug resistance . Targeting YebN could disrupt membrane homeostasis in multidrug-resistant pathogens.

Future Directions

  • Structural Studies: Cryo-EM or X-ray crystallography to resolve YebN’s topology .

  • Functional Knockouts: Assess YebN’s role in ETEC adhesion and biofilm formation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
mntP; yebN; EcE24377A_2050; Probable manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Escherichia coli O139:H28 (strain E24377A / ETEC)
Target Names
mntP
Target Protein Sequence
MNITATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGML ASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDAM AVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQ ILWTHFHG
Uniprot No.

Target Background

Function

This protein likely functions as a manganese efflux pump.

Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Escherichia coli O139:H28 UPF0059 Membrane Protein YebN?

Recombinant Escherichia coli O139:H28 UPF0059 membrane protein YebN (YebN) is a full-length protein corresponding to amino acids 1-188 of the native protein. It is commonly produced with an N-terminal His-tag to facilitate purification and is expressed in E. coli expression systems . This membrane protein belongs to the UPF0059 family, a group of uncharacterized protein families that require further functional characterization. YebN, like other membrane proteins, contains hydrophobic regions that anchor it within cellular membranes, making its expression and purification challenging compared to soluble proteins.

What Expression Systems Are Commonly Used for YebN Protein Production?

The most common expression system for YebN protein is E. coli, which offers several advantages for membrane protein production:

  • E. coli expression system allows for rapid growth and high protein yields

  • The system supports various fusion tags (such as His-tag) for simplified purification

  • Well-established protocols exist for induction and expression optimization

For recombinant YebN specifically, the protein is typically expressed in E. coli as a fusion protein with an N-terminal His-tag . This approach facilitates subsequent purification steps using affinity chromatography. Alternative expression systems such as mammalian cells (like Expi293F cells used for antibody production) might be considered when specific post-translational modifications or proper folding is required .

How Can Researchers Verify the Expression and Functionality of Recombinant YebN?

Verification of recombinant YebN expression and functionality can be achieved through multiple complementary techniques:

Verification MethodApplicationExpected Results
SDS-PAGEProtein size confirmationSingle band at expected molecular weight (~21 kDa including His-tag)
Western BlotProtein identity confirmationDetection using anti-His antibody or specific anti-YebN antibody
Mass SpectrometryPrecise molecular characterizationMass matching expected protein sequence
Circular DichroismSecondary structure assessmentSpectral pattern characteristic of membrane proteins
Functional AssaysActivity confirmationDependent on specific protein function

For membrane proteins like YebN, functional verification might involve reconstitution into liposomes or nanodiscs to assess membrane integration and potential transport activities. Similar to approaches used for other membrane proteins, researchers can employ immunofluorescence or ligand-binding assays when appropriate antibodies or known ligands are available .

What Are the Major Challenges in Working with Membrane Proteins Like YebN?

Membrane proteins like YebN present several significant challenges for researchers:

  • Expression difficulties: Membrane proteins often express poorly in heterologous systems due to toxicity, improper folding, or aggregation .

  • Solubilization complexity: Extracting membrane proteins requires detergents or other solubilizing agents that can potentially disrupt protein structure and function .

  • Purification obstacles: Once solubilized, maintaining stability throughout purification procedures requires careful optimization of buffer conditions.

  • Structural analysis limitations: Traditional structural determination methods may be complicated by the amphipathic nature of membrane proteins.

  • Functional assay development: Designing appropriate assays to assess membrane protein function often requires reconstitution into artificial membrane systems.

Recent advances have focused on developing better approaches to overcome these challenges, including the use of designed protein WRAPs (Water-soluble RFdiffused Amphipathic Proteins) that can surround hydrophobic surfaces of membrane proteins, rendering them water-soluble without detergents while preserving their native fold and function .

What Are the Latest Techniques for Solubilizing Membrane Proteins Like YebN Without Compromising Structure and Function?

Recent advancements in membrane protein solubilization have focused on developing approaches that maintain native protein structure and function. A cutting-edge technique involves the use of genetically encoded de novo protein WRAPs (Water-soluble RFdiffused Amphipathic Proteins) . This deep learning-based design approach creates proteins that:

  • Surround the lipid-interacting hydrophobic surfaces of membrane proteins

  • Render membrane proteins stable and water-soluble without detergents

  • Preserve the sequence, fold, and function of the native membrane protein

  • Enhance stability compared to detergent-solubilized proteins

This approach has been successfully applied to both beta-barrel outer membrane and helical multi-pass transmembrane proteins . For YebN research, this method could potentially overcome traditional solubilization challenges by eliminating the need for detergents that can destabilize membrane proteins.

The WRAP technique represents a significant improvement over conventional methods such as:

  • Traditional detergent solubilization (SDS, DDM, LDAO)

  • Amphipols and nanodiscs

  • Membrane scaffold proteins

The value of this approach is demonstrated by its successful application to membrane proteins from various organisms, resulting in solubilized proteins that retain binding and enzymatic functions with enhanced stability .

How Can Deep Learning Approaches Enhance Membrane Protein Research?

Deep learning approaches are revolutionizing membrane protein research through several key applications:

  • Protein design: Deep learning algorithms can design novel proteins that interact with membrane proteins, as demonstrated by the WRAP technology that creates water-soluble versions of membrane proteins . This approach uses neural networks trained on protein structure data to predict protein sequences that will fold into structures capable of shielding hydrophobic surfaces.

  • Structure prediction: AI systems can predict membrane protein structures with increasing accuracy, helping researchers understand proteins like YebN even when experimental structures are unavailable.

  • Function prediction: Neural networks trained on sequence and structural data can predict potential functions, binding partners, and catalytic activities of poorly characterized membrane proteins.

  • Data integration: Machine learning methods can help resolve contradictions in experimental data by finding patterns across diverse datasets, similar to how contradiction resolution approaches have been applied in other domains .

For YebN specifically, deep learning could potentially predict structural features, functional domains, and interaction partners based on its sequence, even in the absence of extensive experimental data. This would provide valuable hypotheses for experimental validation and guide research directions.

What Methods Are Most Effective for Studying Protein-Protein Interactions Involving Membrane Proteins Like YebN?

Studying protein-protein interactions involving membrane proteins like YebN requires specialized approaches:

MethodAdvantagesLimitationsApplication to YebN
Co-immunoprecipitationDetects interactions in near-native conditionsRequires specific antibodiesCould be performed using anti-His antibodies for tagged YebN
Proximity labeling (BioID, APEX)Identifies transient interactions in living cellsPotential false positivesCould map YebN interaction network in bacterial membranes
Cross-linking mass spectrometryIdentifies direct binding interfacesComplex data analysisCould reveal specific interaction domains of YebN
FRET/BRETReal-time interaction monitoring in living cellsRequires fluorescent protein fusionsCould monitor dynamic YebN interactions
Yeast two-hybrid variantsHigh-throughput screeningPotential false positives/negativesModified membrane Y2H could identify YebN partners

For membrane proteins specifically, the development of WRAP technology provides a novel approach to studying interactions. By solubilizing membrane proteins while maintaining their native conformation, WRAP-stabilized proteins can be used in standard biochemical assays that would otherwise be challenging with detergent-solubilized samples . This approach could potentially be applied to YebN to study its interactions with other proteins in solution-based assays.

How Can Researchers Address Data Contradictions in Membrane Protein Studies?

Data contradictions in membrane protein studies are common due to the technical challenges associated with these proteins. Researchers can address these contradictions through several approaches:

  • Multi-technique validation: Using complementary methods to verify findings can help resolve contradictions. For example, combining functional assays with structural studies and computational predictions.

  • Systematic condition screening: Testing multiple experimental conditions (detergents, buffers, temperature, pH) can identify variables that contribute to contradictory results.

  • Information-theoretic contradiction resolution: Drawing from information theory approaches, researchers can systematically address contradictions by examining data at different levels. This involves resolving contradictions between individual observations (self-evaluation) and collective data trends (outer-evaluation) .

  • Reference protein comparisons: Including well-characterized membrane proteins as references in experiments can help identify method-specific artifacts versus true protein properties.

  • Data modeling approaches: Statistical and computational modeling can help integrate contradictory datasets and identify underlying patterns, similar to how contradiction resolution has been applied to improve prediction performance in other fields .

When studying YebN specifically, researchers should be aware that different experimental conditions might lead to contradictory results about its structure, interactions, or function. Systematic documentation of all experimental parameters and cross-validation across multiple techniques are essential for resolving such contradictions.

What Strategies Can Improve the Production and Purification of Difficult Membrane Proteins?

Production and purification of challenging membrane proteins like YebN can be improved through several strategic approaches:

  • Optimized expression systems:

    • Selection of appropriate host strains (e.g., C41/C43 for toxic membrane proteins)

    • Use of specialized expression vectors with tunable promoters

    • Co-expression with chaperones to aid proper folding

    • Membrane-targeting signal sequence optimization

  • Expression condition optimization:

    • Lower induction temperatures (16-25°C) to slow production and improve folding

    • Careful selection of induction agents and concentrations

    • Supplementation with specific lipids or additives that stabilize the target protein

  • Novel solubilization approaches:

    • Application of WRAP technology for detergent-free solubilization

    • Screening of diverse detergent classes and concentrations

    • Use of amphipols or nanodiscs for increased stability

  • Advanced purification strategies:

    • Multiple orthogonal purification tags (e.g., His-tag as used with YebN)

    • Size exclusion chromatography to separate monomeric protein from aggregates

    • On-column detergent exchange to improve stability

  • Stability enhancement:

    • Addition of specific lipids during purification

    • Point mutations to improve stability while maintaining function

    • Identification and optimization of buffer components

These strategies have been successfully applied to various membrane proteins and could be adapted for YebN production. For instance, YebN is currently expressed with an N-terminal His-tag in E. coli , but additional optimization of expression conditions or application of newer techniques like WRAP technology could potentially improve yields and stability for structural and functional studies.

How Can Recombinant Antibodies Be Generated Against Membrane Proteins Like YebN?

Generation of recombinant antibodies against membrane proteins like YebN involves several specialized steps:

  • Antigen preparation: For membrane proteins, this typically involves:

    • Expression and purification of the target protein with fusion tags

    • Selection of specific domains or peptides for immunization

    • Proper presentation of native-like epitopes

  • Antibody generation approaches:

    • Hybridoma technology followed by sequencing and recombinant production

    • Phage display libraries screening against the target protein

    • Single B-cell isolation and antibody gene amplification

  • Recombinant antibody production:

    • Cloning of antibody variable regions into expression vectors

    • Expression in mammalian cells like Expi293F

    • Purification using Protein A Sepharose columns

  • Validation of specificity:

    • Immunofluorescence to confirm target recognition

    • RNAi knockdown to verify specificity (similar to BubR1 and Mad2-C antibody validation)

    • Western blotting to detect the target protein

    • Functional assays to assess antibody effects

For membrane proteins like YebN specifically, researchers often face challenges related to generating antibodies against conformational epitopes. Using approaches similar to those employed for other proteins, such as maintaining the native conformation during immunization or selecting accessible epitopes, can improve success rates .

What Quality Control Methods Should Be Applied When Working With Recombinant YebN?

Quality control for recombinant YebN should include comprehensive assessments at multiple stages:

Quality Control StepMethodExpected Outcome for YebN
Identity VerificationMass spectrometryConfirmation of expected molecular weight (~21 kDa with His-tag)
Purity AssessmentSDS-PAGE + densitometry>90% purity for most applications
Structural IntegrityCircular dichroismCharacteristic membrane protein secondary structure
Oligomeric StateSize exclusion chromatographyConfirmation of expected oligomeric state
Functional ActivityAssay dependent on YebN functionActivity comparable to native protein
Endotoxin TestingLAL assay<0.1 EU/μg for most research applications
Stability TestingAccelerated stability studiesPredictable degradation profile

For His-tagged recombinant YebN specifically, researchers should verify complete binding to Ni-NTA resin during purification and assess tag accessibility using anti-His antibodies . Additionally, for membrane proteins, it's essential to verify proper membrane integration or reconstitution by techniques such as proteoliposome flotation assays or tryptophan fluorescence.

Quality control should be documented with appropriate acceptance criteria established based on the intended experimental use of the protein. This systematic approach ensures that experimental results are attributable to the protein's properties rather than quality issues.

What Are the Most Promising Future Research Directions for YebN Protein Studies?

Future research on YebN protein could profitably focus on several promising directions:

  • Structural characterization: Applying cutting-edge techniques like cryo-EM or X-ray crystallography to determine the high-resolution structure, potentially facilitated by WRAP technology for improved protein stability .

  • Functional elucidation: Developing systematic assays to identify the specific cellular function of YebN, including potential roles in transport, signaling, or membrane integrity.

  • Interaction network mapping: Using proximity labeling or WRAP-stabilized protein for interaction studies to place YebN in its cellular context and understand its biological role .

  • Comparative genomics: Analyzing YebN homologs across different bacterial species to identify conserved features and potential functional clues through evolutionary analysis.

  • Applied biotechnology: Exploring potential applications of YebN in biotechnology, such as biosensors, drug screening platforms, or synthetic biology circuits.

These research directions could benefit from emerging technologies like the WRAP approach for membrane protein solubilization and advanced recombinant antibody generation techniques . By combining multiple approaches and leveraging new methodologies, researchers can overcome the traditional challenges associated with membrane protein research and advance our understanding of this understudied protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.