Recombinant Escherichia coli O139:H28 UPF0114 protein YqhA (YqhA) is a protein expressed in E. coli and fused to an N-terminal His tag . The YqhA protein is encoded by the yqhA gene and is also known as UPF0114 protein YqhA .
Characteristics:
The yqhA gene encodes the UPF0114 protein YqhA . Research indicates that yqhA is present in various E. coli strains, including O139:H28 strain E24377A .
The amino acid sequence for the Recombinant Full Length Escherichia coli O139:H28 UPF0114 protein YqhA(yqhA) Protein is :
MERFLENAMYASRWLLAPVYFGLSLALVALALKFFQEIIHVLPNIFSMAESDLILVLLSL
VDMTLVGGLLVMVMFSGYENFVSQLDISENKEKLNWLGKMDATSLKNKVAASIVAISSIH
LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH
While the specific function of YqhA is not fully characterized, studies provide some insights:
Biofilm Formation: Mutating asp4, which affects adherence to glycoprotein gp340, reduces biofilm development .
Antibiotic Resistance: Research has identified genes, including yihO, yhdP, and waaY, essential for maintaining high-level antimicrobial resistance in E. coli . Disruption of yhdP increases the outer membrane's permeability, while yihO codes for the first protein in the sulfoglycolysis pathway .
Outer Membrane Protein Assembly: The outer membrane (OM) of gram-negative bacteria contains outer membrane proteins (OMPs) that fold into a unique β-barrel transmembrane domain . BamE enhances the stability of essential subunit binding and is responsible for the full efficiency of the assembly of all tested OMPs .
E. coli O139:H28 is a serotype that has been identified in enterotoxigenic E. coli (ETEC) strains . ETEC strains colonize the lower gut and can possess virulence genes such as eltA and eltB, which encode heat-labile enterotoxin subunits . E. coli strains isolated from intestinal diseases are grouped into pathotypes, with hybrids showing relatedness to ETEC and STEC/ETEC strains, suggesting acquisition of virulence genes . E. coli O157:H7 strains possess lpf loci encoding fimbrial structures involved in intestinal colonization .
Recombinant YqhA protein can be utilized in research applications such as:
KEGG: ecw:EcE24377A_3471
Recombinant YqhA is commonly expressed in E. coli expression systems. The full-length protein (1-164aa) can be successfully expressed with an N-terminal His tag to facilitate purification. The methodological approach involves:
Cloning the yqhA gene into an appropriate expression vector
Transforming the construct into E. coli host cells
Inducing protein expression under optimized conditions
Lysing cells and purifying the protein using affinity chromatography (His-tag purification)
The expressed protein is typically provided as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE . For functional studies, proper reconstitution is critical:
Briefly centrifuge the vial prior to opening
Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL
Add glycerol to 5-50% final concentration for long-term storage
Achieving high soluble expression of transmembrane proteins like YqhA requires careful optimization of multiple parameters. Based on experimental design approaches with similar proteins, the following strategies are recommended:
Employ multivariant statistical experimental design methodology rather than traditional univariant approaches
Simultaneously optimize induction conditions (temperature, IPTG concentration, induction time) and media composition
Balance cell growth maximization with protein solubility
This approach has demonstrated success in achieving high yields (250 mg/L) of soluble expression for recombinant proteins in E. coli while maintaining functional activity . For YqhA specifically, consideration of its membrane-associated nature requires special attention to:
Optimal detergent selection for extraction
Temperature reduction during induction (often 16-25°C)
Co-expression with molecular chaperones
Addition of specific membrane-stabilizing components to the culture medium
Due to the sensitivity of membrane proteins to denaturation during storage, proper handling of recombinant YqhA is essential for maintaining its structural integrity and functional activity. The recommended storage protocol includes:
Store lyophilized powder at -20°C/-80°C upon receipt
Aliquot reconstituted protein to avoid repeated freeze-thaw cycles
Store working aliquots at 4°C for no more than one week
Use Tris/PBS-based buffer with 6% Trehalose, pH 8.0 as storage buffer
Repeated freezing and thawing significantly diminishes protein quality and should be strictly avoided. For long-term storage, addition of glycerol to a final concentration of 50% is recommended before storing at -20°C/-80°C .
While the precise function of YqhA in E. coli remains largely uncharacterized, evidence points to its potential role in stress response and adaptation. In Bacillus subtilis, YqhA has been identified as a paralog to rsbR, which encodes the positive regulator of sigma factor σB and functions in the environmental signaling branch of the general stress response . This suggests a potential role of E. coli YqhA in stress modulation.
Recent research has identified YqhA as potentially significant in microbial adaptation to environmental stressors. In adaptive evolution experiments, mutations in YqhA have been associated with enhanced tolerance to lignocellulose-derived inhibitors in E. coli strains, suggesting its involvement in stress response mechanisms .
In adaptively evolved E. coli strains, a specific mutation in YqhA (W14L) has been identified that contributes to increased tolerance to lignocellulose-derived inhibitors. The mutation occurs at position 3,016,868 within the yqhA gene, where the original base pair cytosine was altered to adenine, changing the 14th amino acid from tryptophan to leucine .
The functional significance of this mutation can be understood through the properties of these amino acids:
Tryptophan typically prefers to be buried in protein hydrophobic cores
Leucine is also hydrophobic and prone to be buried in protein hydrophobic cores within α-helices
While leucine side chains are non-reactive and rarely directly involved in protein catalysis, they play important roles in substrate recognition, especially in binding/recognition of hydrophobic ligands such as lipids, phenols, and furfural
This is consistent with YqhA's membrane location and its potential role in signal transduction, binding, recognition, and transport of chemicals. The W14L mutation site is adjacent to a helical transmembrane region (positions 15-35), suggesting it may alter the protein's interaction with membrane components or transported molecules .
The following table summarizes the mutations found in adaptively evolved E. coli strains with enhanced inhibitor tolerance:
| Strain | Gene | Product description | Location | Class | Nucleotide | Codon | Protein change |
|---|---|---|---|---|---|---|---|
| E. coli-L | yqhA | UPF0114 protein | Plasma membrane | Regulator analog | G41T | TGG → TTG | W14L |
| E. coli-H | yqhA | UPF0114 protein | Plasma membrane | Regulator analog | G41T | TGG → TTG | W14L |
Table: Mutation details identified in yqhA from adaptively evolved E. coli strains
To investigate YqhA's potential role in stress response and adaptation, a comprehensive experimental approach should include:
Gene knockout and complementation studies:
Generate yqhA knockout strains
Complement with wild-type and mutant versions (e.g., W14L)
Assess phenotypic changes under various stress conditions
Stress tolerance assays:
Expose wild-type and mutant strains to graduated levels of inhibitors
Measure growth rates, survival, and metabolic activity
Determine minimum inhibitory concentrations (MICs)
Protein localization and interaction studies:
Fluorescent tagging to confirm membrane localization
Co-immunoprecipitation to identify interaction partners
Bacterial two-hybrid assays to map protein-protein interactions
Transcriptomic and proteomic analyses:
RNA-seq to identify differentially expressed genes in wild-type vs. mutant strains
Proteomics to identify altered protein expression patterns
Focus on stress-response pathways and signaling cascades
Structural characterization of YqhA presents significant challenges due to its transmembrane nature, but several approaches can yield valuable insights:
Homology modeling:
While previous homology modeling attempts showed only 48% confidence with the highest scoring template (the Mrp antiporter complex, PDB-entry: 6z16c) , improved results might be achieved by:
Using newer structural databases with more membrane protein templates
Employing AI-based structure prediction tools like AlphaFold2
Validating models with experimental data
Cryo-electron microscopy:
Suitable for membrane proteins without need for crystallization
Can resolve structures in near-native lipid environments
May require protein engineering to increase stability
Site-directed mutagenesis:
Systematic mutation of key residues, particularly around the W14L site
Functional assays to correlate structural changes with phenotypic effects
Thermostability assays to assess effects on protein folding and stability
YqhA research connects to the larger field of bacterial stress response mechanisms, particularly in the context of adaptation to environmental stressors. Several significant connections can be made:
Global regulation networks: The mutations in yqhA and other regulatory elements (rssB, basR, and the promoter region of yqhD-dkgA operon) in adaptively evolved strains suggest that global regulation plays a key role in cellular tolerance to lignocellulose-derived inhibitors .
Stress response signaling: The identification of YqhA as a potential stress modulator, based on its homology to the B. subtilis rsbR gene (involved in σB regulation), suggests its participation in stress response signaling pathways .
Membrane-associated stress responses: As a transmembrane protein, YqhA may be involved in sensing and responding to membrane-disrupting stressors, connecting membrane integrity to cellular stress response mechanisms.
The identification of YqhA mutations in adaptively evolved E. coli strains has significant implications for metabolic engineering and synthetic biology approaches:
Bioprocess optimization: Engineered strains with YqhA modifications could enable more efficient utilization of lignocellulosic feedstocks without extensive pretreatment steps.
Genetic engineering targets: The four mutations identified in adaptively evolved strains (including yqhA and the promoter region of yqhD-dkgA operon) represent promising targets for genetic engineering to enhance tolerance to multiple lignocellulosic inhibitors .
Cross-species applications: The regulatory function of YqhA could potentially be exploited in other microbial production platforms to extend production yield, titer, and efficiency of various bio-based products from undetoxified lignocellulosic hydrolysate or pyrolysate .