Recombinant Escherichia coli O139:H28 UPF0114 protein YqhA (yqhA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Escherichia coli O139:H28 UPF0114 Protein YqhA (yqhA)

Recombinant Escherichia coli O139:H28 UPF0114 protein YqhA (YqhA) is a protein expressed in E. coli and fused to an N-terminal His tag . The YqhA protein is encoded by the yqhA gene and is also known as UPF0114 protein YqhA .

Characteristics:

  • Source: Escherichia coli

  • Tag: His

  • Protein Length: Full Length (1-164 amino acids)

  • Purity: Greater than 90% as determined by SDS-PAGE

  • Gene Name: yqhA

  • Synonyms: yqhA; EcE24377A_3471; UPF0114 protein YqhA

  • UniProt ID: A7ZRN9

Gene Information

The yqhA gene encodes the UPF0114 protein YqhA . Research indicates that yqhA is present in various E. coli strains, including O139:H28 strain E24377A .

Protein Sequence

The amino acid sequence for the Recombinant Full Length Escherichia coli O139:H28 UPF0114 protein YqhA(yqhA) Protein is :

MERFLENAMYASRWLLAPVYFGLSLALVALALKFFQEIIHVLPNIFSMAESDLILVLLSL
VDMTLVGGLLVMVMFSGYENFVSQLDISENKEKLNWLGKMDATSLKNKVAASIVAISSIH
LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH

Function and Role

While the specific function of YqhA is not fully characterized, studies provide some insights:

  • Biofilm Formation: Mutating asp4, which affects adherence to glycoprotein gp340, reduces biofilm development .

  • Antibiotic Resistance: Research has identified genes, including yihO, yhdP, and waaY, essential for maintaining high-level antimicrobial resistance in E. coli . Disruption of yhdP increases the outer membrane's permeability, while yihO codes for the first protein in the sulfoglycolysis pathway .

  • Outer Membrane Protein Assembly: The outer membrane (OM) of gram-negative bacteria contains outer membrane proteins (OMPs) that fold into a unique β-barrel transmembrane domain . BamE enhances the stability of essential subunit binding and is responsible for the full efficiency of the assembly of all tested OMPs .

Escherichia coli O139:H28 and Pathogenicity

E. coli O139:H28 is a serotype that has been identified in enterotoxigenic E. coli (ETEC) strains . ETEC strains colonize the lower gut and can possess virulence genes such as eltA and eltB, which encode heat-labile enterotoxin subunits . E. coli strains isolated from intestinal diseases are grouped into pathotypes, with hybrids showing relatedness to ETEC and STEC/ETEC strains, suggesting acquisition of virulence genes . E. coli O157:H7 strains possess lpf loci encoding fimbrial structures involved in intestinal colonization .

Applications

Recombinant YqhA protein can be utilized in research applications such as:

  • Protein Characterization: Studying its structure, interactions, and potential functions within E. coli .

  • Drug Discovery: Investigating its role in antibiotic resistance mechanisms .

  • Vaccine Development: Exploring its potential as a vaccine target .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
yqhA; EcE24377A_3471; UPF0114 protein YqhA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Escherichia coli O139:H28 (strain E24377A / ETEC)
Target Names
yqhA
Target Protein Sequence
MERFLENAMYASRWLLAPVYFGLSLALVALALKFFQEIIHVLPNIFSMAESDLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDISENKEKLNWLGKMDATSLKNKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How is recombinant YqhA typically expressed and purified?

Recombinant YqhA is commonly expressed in E. coli expression systems. The full-length protein (1-164aa) can be successfully expressed with an N-terminal His tag to facilitate purification. The methodological approach involves:

  • Cloning the yqhA gene into an appropriate expression vector

  • Transforming the construct into E. coli host cells

  • Inducing protein expression under optimized conditions

  • Lysing cells and purifying the protein using affinity chromatography (His-tag purification)

The expressed protein is typically provided as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE . For functional studies, proper reconstitution is critical:

  • Briefly centrifuge the vial prior to opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration for long-term storage

  • Aliquot to avoid repeated freeze-thaw cycles

What expression system optimization strategies should be considered for high-yield soluble YqhA production?

Achieving high soluble expression of transmembrane proteins like YqhA requires careful optimization of multiple parameters. Based on experimental design approaches with similar proteins, the following strategies are recommended:

  • Employ multivariant statistical experimental design methodology rather than traditional univariant approaches

  • Simultaneously optimize induction conditions (temperature, IPTG concentration, induction time) and media composition

  • Balance cell growth maximization with protein solubility

This approach has demonstrated success in achieving high yields (250 mg/L) of soluble expression for recombinant proteins in E. coli while maintaining functional activity . For YqhA specifically, consideration of its membrane-associated nature requires special attention to:

  • Optimal detergent selection for extraction

  • Temperature reduction during induction (often 16-25°C)

  • Co-expression with molecular chaperones

  • Addition of specific membrane-stabilizing components to the culture medium

What are the recommended storage conditions for recombinant YqhA protein?

Due to the sensitivity of membrane proteins to denaturation during storage, proper handling of recombinant YqhA is essential for maintaining its structural integrity and functional activity. The recommended storage protocol includes:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for no more than one week

  • Use Tris/PBS-based buffer with 6% Trehalose, pH 8.0 as storage buffer

Repeated freezing and thawing significantly diminishes protein quality and should be strictly avoided. For long-term storage, addition of glycerol to a final concentration of 50% is recommended before storing at -20°C/-80°C .

What is known about the functional role of YqhA in E. coli?

While the precise function of YqhA in E. coli remains largely uncharacterized, evidence points to its potential role in stress response and adaptation. In Bacillus subtilis, YqhA has been identified as a paralog to rsbR, which encodes the positive regulator of sigma factor σB and functions in the environmental signaling branch of the general stress response . This suggests a potential role of E. coli YqhA in stress modulation.

Recent research has identified YqhA as potentially significant in microbial adaptation to environmental stressors. In adaptive evolution experiments, mutations in YqhA have been associated with enhanced tolerance to lignocellulose-derived inhibitors in E. coli strains, suggesting its involvement in stress response mechanisms .

How does the W14L mutation in YqhA contribute to inhibitor tolerance in evolved E. coli strains?

In adaptively evolved E. coli strains, a specific mutation in YqhA (W14L) has been identified that contributes to increased tolerance to lignocellulose-derived inhibitors. The mutation occurs at position 3,016,868 within the yqhA gene, where the original base pair cytosine was altered to adenine, changing the 14th amino acid from tryptophan to leucine .

The functional significance of this mutation can be understood through the properties of these amino acids:

  • Tryptophan typically prefers to be buried in protein hydrophobic cores

  • Leucine is also hydrophobic and prone to be buried in protein hydrophobic cores within α-helices

  • While leucine side chains are non-reactive and rarely directly involved in protein catalysis, they play important roles in substrate recognition, especially in binding/recognition of hydrophobic ligands such as lipids, phenols, and furfural

This is consistent with YqhA's membrane location and its potential role in signal transduction, binding, recognition, and transport of chemicals. The W14L mutation site is adjacent to a helical transmembrane region (positions 15-35), suggesting it may alter the protein's interaction with membrane components or transported molecules .

The following table summarizes the mutations found in adaptively evolved E. coli strains with enhanced inhibitor tolerance:

StrainGeneProduct descriptionLocationClassNucleotideCodonProtein change
E. coli-LyqhAUPF0114 proteinPlasma membraneRegulator analogG41TTGG → TTGW14L
E. coli-HyqhAUPF0114 proteinPlasma membraneRegulator analogG41TTGG → TTGW14L

Table: Mutation details identified in yqhA from adaptively evolved E. coli strains

What experimental approaches are recommended for studying YqhA's role in stress modulation?

To investigate YqhA's potential role in stress response and adaptation, a comprehensive experimental approach should include:

  • Gene knockout and complementation studies:

    • Generate yqhA knockout strains

    • Complement with wild-type and mutant versions (e.g., W14L)

    • Assess phenotypic changes under various stress conditions

  • Stress tolerance assays:

    • Expose wild-type and mutant strains to graduated levels of inhibitors

    • Measure growth rates, survival, and metabolic activity

    • Determine minimum inhibitory concentrations (MICs)

  • Protein localization and interaction studies:

    • Fluorescent tagging to confirm membrane localization

    • Co-immunoprecipitation to identify interaction partners

    • Bacterial two-hybrid assays to map protein-protein interactions

  • Transcriptomic and proteomic analyses:

    • RNA-seq to identify differentially expressed genes in wild-type vs. mutant strains

    • Proteomics to identify altered protein expression patterns

    • Focus on stress-response pathways and signaling cascades

How can structural biology approaches be applied to better understand YqhA function?

Structural characterization of YqhA presents significant challenges due to its transmembrane nature, but several approaches can yield valuable insights:

  • Homology modeling:
    While previous homology modeling attempts showed only 48% confidence with the highest scoring template (the Mrp antiporter complex, PDB-entry: 6z16c) , improved results might be achieved by:

    • Using newer structural databases with more membrane protein templates

    • Employing AI-based structure prediction tools like AlphaFold2

    • Validating models with experimental data

  • Cryo-electron microscopy:

    • Suitable for membrane proteins without need for crystallization

    • Can resolve structures in near-native lipid environments

    • May require protein engineering to increase stability

  • Site-directed mutagenesis:

    • Systematic mutation of key residues, particularly around the W14L site

    • Functional assays to correlate structural changes with phenotypic effects

    • Thermostability assays to assess effects on protein folding and stability

How does YqhA research relate to broader studies on bacterial stress responses?

YqhA research connects to the larger field of bacterial stress response mechanisms, particularly in the context of adaptation to environmental stressors. Several significant connections can be made:

  • Global regulation networks: The mutations in yqhA and other regulatory elements (rssB, basR, and the promoter region of yqhD-dkgA operon) in adaptively evolved strains suggest that global regulation plays a key role in cellular tolerance to lignocellulose-derived inhibitors .

  • Stress response signaling: The identification of YqhA as a potential stress modulator, based on its homology to the B. subtilis rsbR gene (involved in σB regulation), suggests its participation in stress response signaling pathways .

  • Membrane-associated stress responses: As a transmembrane protein, YqhA may be involved in sensing and responding to membrane-disrupting stressors, connecting membrane integrity to cellular stress response mechanisms.

What are the implications of YqhA mutations for metabolic engineering and synthetic biology?

The identification of YqhA mutations in adaptively evolved E. coli strains has significant implications for metabolic engineering and synthetic biology approaches:

  • Bioprocess optimization: Engineered strains with YqhA modifications could enable more efficient utilization of lignocellulosic feedstocks without extensive pretreatment steps.

  • Genetic engineering targets: The four mutations identified in adaptively evolved strains (including yqhA and the promoter region of yqhD-dkgA operon) represent promising targets for genetic engineering to enhance tolerance to multiple lignocellulosic inhibitors .

  • Cross-species applications: The regulatory function of YqhA could potentially be exploited in other microbial production platforms to extend production yield, titer, and efficiency of various bio-based products from undetoxified lignocellulosic hydrolysate or pyrolysate .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.