Recombinant Escherichia coli O139:H28 UPF0208 membrane protein YfbV (yfbV)

What is the molecular characterization of Recombinant E. coli UPF0208 membrane protein YfbV?

Recombinant E. coli UPF0208 membrane protein YfbV is a 151-amino acid membrane protein that can be expressed with an N-terminal His tag in E. coli expression systems. The full amino acid sequence is: MSTPDNRSVNFFSLFRRGQHYSKTWPLEKRLAPFVENRVIKMTRYAIRFMPPIAVFTLCWQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPAILNWFYEVRGKLQESGQVLAPVEGKPDYQALADTLKRAFKQLDKTFLDDL . The protein has a UniProt ID of C4ZVI8 and is also known as BWG_2069 . As a membrane protein, YfbV contains hydrophobic regions that integrate into the cell membrane, which presents specific challenges for expression and purification different from those encountered with soluble proteins.

What expression systems are recommended for producing recombinant YfbV protein?

For recombinant YfbV production, E. coli expression systems are primarily recommended due to their compatibility with the protein's native environment. Similar to approaches used for other E. coli membrane proteins like OmpF, the auto-induction method can be employed for expression, which allows for high cell density cultivation without the need for monitoring growth and manual induction . When designing expression vectors, incorporating a His-tag facilitates subsequent purification processes. The pET vector system (such as pET-28a) has been successfully used for similar membrane proteins, where the protein coding sequence is placed under control of a strong T7 promoter . Expression conditions should be optimized at lower temperatures (around 30°C) to reduce the formation of inclusion bodies and enhance proper membrane integration.

What are the recommended purification strategies for recombinant YfbV?

Purification of recombinant YfbV with an N-terminal His-tag can be accomplished using Ni²⁺-NTA affinity chromatography, similar to methods used for other E. coli membrane proteins . The purification protocol should include:

• Cell lysis under native or denaturing conditions (depending on protein localization)

• Membrane isolation through differential centrifugation if the protein is properly integrated

• Solubilization using appropriate detergents (such as LDAO) to extract the protein from membranes

• Affinity chromatography using Ni²⁺-NTA resin

• Washing with increasing imidazole concentrations to remove non-specific binding

• Elution with high imidazole buffer

This approach typically yields protein with >90% purity, sufficient for most research applications . If higher purity is required, additional purification steps such as size exclusion chromatography may be implemented.

How should recombinant YfbV be stored to maintain stability and activity?

Based on available data for recombinant YfbV and similar membrane proteins, the following storage conditions are recommended:

The protein should be reconstituted to a concentration of 0.1-1.0 mg/mL in deionized sterile water . To prevent protein degradation during repeated freeze-thaw cycles, it is advisable to add glycerol (final concentration 5-50%, with 50% being standard) and prepare small aliquots for single use . Working aliquots can be stored at 4°C for up to one week to avoid repeated freeze-thaw cycles that may compromise protein integrity.

What experimental approaches can be used to investigate the structure-function relationship of YfbV?

The structure-function relationship of YfbV can be investigated through multiple complementary approaches:

• Structural Analysis:

  • X-ray crystallography: Requires high-purity protein and suitable crystallization conditions

  • Cryo-electron microscopy: Useful for membrane proteins without the need for crystallization

  • NMR spectroscopy: Can provide information about protein dynamics in membrane-mimetic environments

• Functional Characterization:

  • Site-directed mutagenesis: Targeting conserved residues to determine functional importance

  • Chimeric protein construction: Swapping domains with related proteins to identify functional regions

  • In vitro assays: Measuring specific activities associated with membrane transport or signaling

• Computational Methods:

  • Homology modeling: Based on structures of related UPF0208 family proteins

  • Molecular dynamics simulations: To predict conformational changes in membrane environments

The relatively small size of YfbV (151 amino acids) makes it amenable to these approaches, though its membrane association presents challenges that must be addressed through appropriate detergent selection or membrane mimetics during analysis.

How does the immunogenic potential of YfbV compare with other E. coli membrane proteins like OmpF?

While specific immunogenicity data for YfbV is limited, comparative analysis with well-studied E. coli membrane proteins like OmpF can provide valuable insights:

OmpF has demonstrated significant immunogenic properties, with:

• Ability to induce high antibody titers (1:240,000 against purified protein, 1:27,000 against whole cells)

• Capacity to stimulate opsonophagocytosis (72.21 ± 11.39% bacteria killed in immunized groups vs. 11.04 ± 3.90% in control groups)

• Partial protection (40-60% survival) in mouse infection models

For YfbV, immunogenicity assessment would require:

• Animal immunization studies using purified recombinant YfbV

• Evaluation of antibody titers by iELISA

• Assessment of antibody binding to bacterial surface by flow cytometry

• Functional assays (opsonophagocytosis, bactericidal activity)

• In vivo challenge studies to evaluate protection

The high purity (>90%) achievable for recombinant YfbV is comparable to that of other immunogenic proteins, suggesting it could serve as an effective antigen if it contains appropriate epitopes . Homology analysis similar to that performed for OmpF would help predict cross-reactivity with other bacterial species.

What are the methodological considerations for analyzing membrane integration and topology of YfbV?

Analyzing membrane integration and topology of YfbV requires specialized approaches:

• Biochemical Methods:

  • Protease protection assays: Limited proteolysis of intact versus disrupted membranes can identify exposed regions

  • Chemical labeling: Using membrane-impermeable reagents to identify surface-exposed amino acids

  • Glycosylation mapping: Engineering glycosylation sites to determine lumenal versus cytoplasmic orientation

• Biophysical Techniques:

  • Fluorescence resonance energy transfer (FRET): To measure distances between domains

  • Electron paramagnetic resonance (EPR): Using spin-labeled residues to determine accessibility

  • Attenuated total reflection Fourier-transform infrared spectroscopy (ATR-FTIR): To analyze secondary structure in membranes

• In silico Prediction:

  • Hydrophobicity analysis: Identifying potential transmembrane regions

  • Topology prediction algorithms: Such as TMHMM, TopPred, or MEMSAT

• Reporter Fusion Approaches:

  • PhoA/LacZ fusion analysis: Creating fusion proteins with reporters having activity dependent on cellular location

  • GFP fluorescence: Analyzing cellular localization through fluorescence microscopy

Each method has specific advantages and limitations, and a comprehensive topological map typically requires combining multiple approaches.

How can researchers address solubility and refolding challenges when working with recombinant YfbV?

Membrane proteins like YfbV often present solubility challenges and may form inclusion bodies during expression. Based on strategies used for similar proteins such as OmpF, researchers can address these issues through:

• Prevention of Inclusion Body Formation:

  • Lower expression temperatures (16-30°C)

  • Reduced inducer concentration

  • Co-expression with molecular chaperones

  • Use of fusion partners that enhance solubility

• Solubilization of Inclusion Bodies:

  • Denaturation with urea (6-8 M) or guanidine hydrochloride

  • Addition of reducing agents to break disulfide bonds

• Refolding Strategies:

  • Dialysis to gradually remove denaturants

  • Pulse refolding by rapid dilution

  • On-column refolding during affinity purification

  • Detergent-assisted refolding using mild detergents like LDAO that simulate natural membrane environments

• Membrane Protein-Specific Approaches:

  • Use of amphipols or nanodiscs to stabilize membrane proteins

  • Incorporation into liposomes or bicelles

  • Detergent screening to identify optimal solubilization conditions

A methodical approach involving screening multiple conditions is often necessary to optimize solubility and refolding, with success verified through functional and structural assays.

What analytical techniques are most effective for assessing the purity and integrity of recombinant YfbV?

Multiple complementary techniques should be employed to thoroughly assess the purity and integrity of recombinant YfbV:

• Protein Purity Assessment:

  • SDS-PAGE: Standard method showing >90% purity based on densitometric analysis

  • Size-exclusion chromatography (SEC): Evaluates protein homogeneity and aggregation state

  • Mass spectrometry: Provides precise molecular weight and can identify truncations or modifications

• Protein Identity Confirmation:

  • Western blotting: Using anti-His antibodies to confirm identity of tagged protein

  • Peptide mass fingerprinting: After tryptic digestion to verify sequence

  • N-terminal sequencing: To confirm correct processing

• Structural Integrity Evaluation:

  • Circular dichroism: Assesses secondary structure content

  • Fluorescence spectroscopy: Monitors tertiary structure through intrinsic tryptophan fluorescence

  • Thermal shift assays: Measures protein stability and can detect proper folding

• Functional Characterization:

  • Binding assays: If ligands or interaction partners are known

  • Activity assays: If enzymatic or transport functions are established

A combination of these techniques provides comprehensive quality assessment, with SDS-PAGE and western blotting serving as minimal requirements for basic characterization.

How can researchers optimize heterologous expression of YfbV to maximize yield and proper folding?

Optimizing heterologous expression of membrane proteins like YfbV requires systematic exploration of multiple parameters:

The auto-induction method used successfully for OmpF could be adapted for YfbV, as it allows cells to reach high density before protein expression begins, potentially improving yield . Expression should be verified by SDS-PAGE and western blotting, with optimization targets including total yield, proportion of correctly folded protein, and reduction of inclusion bodies.

What are the critical considerations for designing immunological studies using recombinant YfbV?

When designing immunological studies with recombinant YfbV, researchers should consider:

• Antigen Preparation:

  • Protein purity should exceed 90% to minimize non-specific responses

  • Native conformation may be crucial for exposing relevant epitopes

  • Endotoxin removal is essential to prevent non-specific immune activation

  • Protein concentration optimization (typically 10-50 μg per immunization)

• Immunization Protocol Design:

  • Adjuvant selection (Freund's, alum, or newer adjuvants)

  • Route of administration (subcutaneous, intraperitoneal, intradermal)

  • Timing and number of booster immunizations (typically 2-3 doses at 2-3 week intervals)

  • Sample collection timing for optimal antibody titers

• Immune Response Evaluation:

  • Quantitative analysis: ELISA to determine antibody titers against purified protein and whole bacterial cells

  • Qualitative analysis: Western blotting to confirm specificity

  • Functional assays: Opsonophagocytosis, complement activation, neutralization

  • Cross-reactivity assessment: Testing against related bacterial species

• Protection Studies:

  • Challenge model selection (appropriate pathogenic strain, dose, route)

  • Survival monitoring (40-60% range observed with similar proteins)

  • Bacterial clearance assessment (fecal shedding, tissue burden)

  • Passive immunization studies to confirm antibody-mediated protection

Drawing from experience with OmpF, researchers should anticipate potential weak protection despite strong antibody responses, necessitating optimization of antigen presentation or combination with additional antigens .

What bioinformatic approaches can reveal the evolutionary significance and potential functions of YfbV?

Comprehensive bioinformatic analysis can provide insights into YfbV's evolutionary context and predicted functions:

• Sequence-Based Analysis:

  • Homology searches using BLAST against diverse bacterial genomes

  • Multiple sequence alignment to identify conserved residues

  • Phylogenetic analysis to determine evolutionary relationships

  • Cluster analysis similar to that performed for OmpF to identify strain-specific variations

• Structural Prediction:

  • Secondary structure prediction using PSIPRED or JPred

  • Tertiary structure modeling using homology modeling or threading approaches

  • Protein-protein interaction site prediction

  • Molecular dynamics simulations in membrane environments

• Functional Annotation:

  • Gene neighborhood analysis to identify functional associations

  • Gene ontology (GO) term assignment

  • Domain and motif identification

  • Protein-protein interaction network analysis

• Comparative Genomics:

  • Presence/absence patterns across bacterial species

  • Synteny analysis to identify conserved genomic context

  • Selection pressure analysis (Ka/Ks ratio) to identify evolutionary constraints

  • Horizontal gene transfer prediction

This multifaceted bioinformatic approach could reveal whether YfbV shares the high conservation pattern seen in OmpF (where 46.7% of E. coli strains show 90-100% identity) , providing context for experimental studies and potential applications.

How can researchers address issues with protein degradation during YfbV purification?

Protein degradation during YfbV purification can be minimized through several strategic approaches:

• Protease Inhibition:

  • Include a comprehensive protease inhibitor cocktail during cell lysis

  • Add specific inhibitors based on known proteases in the expression system

  • Consider using protease-deficient E. coli strains (e.g., BL21)

• Buffer Optimization:

  • Maintain optimal pH (typically 7.5-8.0 for membrane proteins)

  • Include stabilizing agents such as trehalose (6%) in storage buffers

  • Test different detergents for their ability to stabilize the protein without promoting aggregation

  • Add reducing agents to prevent oxidation of cysteine residues

• Process Modifications:

  • Reduce processing time by optimizing purification protocols

  • Maintain low temperatures (4°C) throughout purification

  • Consider on-column digestion of fusion tags to minimize handling steps

  • Implement tangential flow filtration for rapid buffer exchange

• Storage Considerations:

  • Add glycerol (5-50%) to prevent freeze-damage

  • Prepare single-use aliquots to avoid repeated freeze-thaw cycles

  • Consider flash-freezing in liquid nitrogen

  • Evaluate lyophilization with appropriate excipients as an alternative storage method

Implementing these strategies should yield stable protein preparations suitable for downstream applications, with purity comparable to the >90% achieved in commercial preparations .

What are the most effective approaches for resolving contradictory experimental results when working with YfbV?

When faced with contradictory experimental results in YfbV research, a systematic troubleshooting approach should be employed:

• Methodological Validation:

  • Replicate experiments using standardized protocols

  • Verify reagent quality and instrument calibration

  • Include appropriate positive and negative controls

  • Blind experimental design and analysis when possible

• Variable Identification and Control:

  • Systematically test protein preparation batches for consistency

  • Control environmental conditions (temperature, pH, ionic strength)

  • Assess the impact of different detergents or membrane mimetics

  • Consider the influence of fusion tags on protein behavior

• Complementary Methodologies:

  • Apply orthogonal techniques to verify results

  • For structural studies, compare X-ray, NMR, and cryo-EM data

  • For functional studies, use both in vitro and in vivo approaches

  • Combine biochemical and biophysical measurements

• Collaborative Verification:

  • Engage external laboratories to independently verify key findings

  • Implement standardized protocols across research groups

  • Compare results using different expression systems or purification methods

  • Document and share detailed experimental conditions

This approach recognizes that membrane proteins like YfbV can be particularly sensitive to experimental conditions, and apparent contradictions may reveal important insights about protein behavior in different environments.

How can researchers differentiate between specific and non-specific effects when conducting functional studies with YfbV?

Differentiating specific from non-specific effects in YfbV functional studies requires rigorous experimental design:

• Control Selection:

  • Use closely related but functionally distinct membrane proteins as controls

  • Include denatured YfbV to control for non-specific effects

  • Employ site-directed mutants affecting predicted functional residues

  • Compare wild-type with tagged and untagged versions to assess tag interference

• Dose-Response Relationships:

  • Establish concentration dependence of observed effects

  • Determine saturability of binding or functional responses

  • Calculate affinity constants (Kd) or kinetic parameters (Km, kcat)

  • Compare with known specific interactions in similar systems

• Competitive Inhibition:

  • Test whether effects can be blocked by specific competitors

  • Use structural analogs to establish structure-activity relationships

  • Employ antibodies targeting specific domains to block function

  • Develop and test small molecule inhibitors with predicted specificity

• Genetic Approaches:

  • Conduct gene knockout/knockdown studies

  • Perform complementation experiments

  • Utilize CRISPR-Cas9 for precise genetic modifications

  • Compare phenotypes with biochemical data for consistency

This comprehensive approach helps distinguish genuine biological functions from artifacts, particularly important for membrane proteins like YfbV where detergents, lipid environments, and purification methods can significantly influence experimental outcomes.

What potential does YfbV hold as a vaccine candidate compared to established E. coli membrane antigens?

Evaluating YfbV as a vaccine candidate requires comparison with established membrane protein antigens like OmpF:

• Antigen Conservation Analysis:

  • YfbV sequence conservation across pathogenic E. coli strains should be assessed similar to OmpF, where 46.7% of E. coli strains showed 90-100% identity

  • Cross-species conservation with related pathogens like Shigella should be examined (52.8% of Shigella strains showed 90-100% identity with E. coli OmpF)

  • Epitope mapping to identify conserved antigenic regions

• Immunological Properties Comparison:

  • Antibody response evaluation (OmpF induced titers of 1:240,000 against purified protein)

  • Cross-reactivity assessment with related bacteria

  • Opsonophagocytosis potential (OmpF immunization resulted in 72.21 ± 11.39% bacterial killing)

  • Protection efficacy in animal models (OmpF provided 40-60% protection)

• Practical Considerations:

  • Expression and purification scalability

  • Stability in vaccine formulations

  • Native conformation preservation during processing

  • Potential for combination with other antigens for broader protection

• Novel Approaches:

  • Epitope-focused design based on bioinformatic prediction

  • Exploration of native forms versus recombinant versions

  • Investigation as a carrier protein for conjugate vaccines

  • Development of nanoparticle-based presentations

While OmpF showed promise but limited protection, YfbV's smaller size (151 vs 341 amino acids) may present different immunological properties that warrant investigation as either a standalone antigen or as part of a multi-component vaccine.

How might structural biology techniques be optimized for characterizing the membrane topology of YfbV?

Optimizing structural biology approaches for YfbV requires addressing the specific challenges of membrane protein characterization:

These approaches can be tailored to address YfbV's relatively small size (151 amino acids) and membrane-associated nature, potentially revealing structural features that explain its biological function and evolutionary conservation.

What experimental designs would best elucidate the physiological role of YfbV in E. coli?

A comprehensive experimental strategy to determine YfbV's physiological role should include:

• Genetic Approaches:

  • Gene deletion and complementation studies

  • Conditional expression systems to control YfbV levels

  • Site-directed mutagenesis of conserved residues

  • Synthetic lethality screening to identify genetic interactions

• Physiological Characterization:

  • Growth curves under various stress conditions (pH, temperature, osmolarity)

  • Membrane integrity assays using fluorescent dyes

  • Cell morphology analysis by microscopy

  • Antibiotic susceptibility testing

• Molecular Interaction Studies:

  • Pull-down assays to identify binding partners

  • Bacterial two-hybrid screening

  • Co-immunoprecipitation with predicted interactors

  • Protein-lipid interaction analysis

• Systems Biology Approaches:

  • Transcriptomics to identify gene expression changes in yfbV mutants

  • Proteomics to detect alterations in protein abundance or modification

  • Metabolomics to characterize biochemical pathway impacts

  • Network analysis to position YfbV in cellular pathways

This multifaceted approach would generate complementary data sets that, when integrated, could reveal YfbV's role in E. coli physiology and potentially identify novel functions not predicted by sequence analysis alone.

How can computational modeling advance our understanding of YfbV structure-function relationships?

Computational modeling offers powerful tools for investigating YfbV's structure-function relationships:

• Homology Modeling and Threading:

  • Template identification from structurally characterized UPF0208 family proteins

  • Model building with membrane-specific force fields

  • Model validation using energy minimization and Ramachandran analysis

  • Refinement against experimental data when available

• Molecular Dynamics Simulations:

  • Membrane embedding using appropriate lipid bilayer compositions

  • Analysis of protein stability and conformational dynamics

  • Identification of water/ion channels or binding pockets

  • Investigation of lipid-protein interactions at the molecular level

• Functional Site Prediction:

  • Conservation mapping onto structural models

  • Electrostatic surface potential calculation

  • Binding site prediction using various algorithms

  • Virtual screening for potential ligands or interaction partners

• Advanced Modeling Approaches:

  • Coarse-grained simulations for longer timescale events

  • Free energy calculations for membrane integration

  • Markov state modeling to identify functional conformational states

  • Machine learning integration for feature prediction