Recombinant Escherichia coli O139:H28 UPF0259 membrane protein yciC (yciC)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Escherichia coli O139:H28 UPF0259 membrane protein YciC (yciC) is a 26.4 kDa protein expressed in E. coli with an N-terminal His tag for purification . It belongs to the UPF0259 family of small, poorly characterized membrane proteins implicated in bacterial metal ion homeostasis and pathogenicity . The protein is encoded by the yciC gene in the E. coli O139:H28 strain E24377A, a clinical isolate associated with enterotoxigenic E. coli (ETEC) infections .

Production Workflow

  • Cloning: Full-length yciC gene inserted into an E. coli expression vector .

  • Expression: Induced under optimized conditions for membrane protein solubility .

  • Purification: Affinity chromatography using Ni-NTA resins targeting the His tag .

Role in Bacterial Pathogenicity

  • Association with APEC Pathotype: Genome-wide association studies (GWAS) identified yciC as a candidate virulence gene in avian pathogenic E. coli (APEC), with a prevalence ratio of 2.61 in APEC vs. avian fecal E. coli (AFEC) .

  • Genetic Network: yciC clusters with genes linked to iron acquisition (iroB, iroE) and outer membrane integrity (ompD) .

GeneAPEC PrevalenceAFEC PrevalenceFunction
yciC75.7%29.0%Uncharacterized membrane protein

Regulatory Mechanisms

  • Zur-Dependent Regulation: Homologs in Bacillus subtilis are tightly regulated by Zur (zinc uptake regulator) via two Zur-binding sites (C1 and C2) .

  • Metal Chaperone Hypothesis: Structural similarities suggest a role in metallation of essential enzymes, though direct evidence in E. coli is limited .

Vaccine Development

  • ETEC Strain E24377A: The parent strain produces CS1 and CS3 colonization factors, making it a candidate for live attenuated vaccine design .

  • Antigenic Potential: While yciC itself is not yet a vaccine target, its membrane localization suggests utility in antibody generation against ETEC .

Membrane Protein Insertion Studies

  • YidC Interaction: UPF0259 proteins may interface with YidC, a translocon component critical for Sec-independent membrane protein assembly .

  • In Vitro Assays: Recombinant YciC facilitates studies on membrane protein folding kinetics and metal ion dependencies .

Challenges and Future Directions

  • Functional Characterization: The exact biochemical role of YciC in E. coli remains unresolved, necessitating targeted mutagenesis and proteomic studies .

  • Structural Validation: Experimental validation of the AlphaFold model via cryo-EM or X-ray crystallography is required .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
yciC; EcE24377A_1413; UPF0259 membrane protein YciC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Escherichia coli O139:H28 (strain E24377A / ETEC)
Target Names
yciC
Target Protein Sequence
MSITAQSVYRDTGNFFRNQFMTILLVSLLCAFITVVLGHVFSPSDAQLAQLNDGVPVSGS SGLFDLVQNMSPEQQQILLQASAASTFSGLIGNAILAGGVILIIQLVSAGQRVSALRAIG ASAPILPKLFILIFLTTLLVQIGIMLVVVPGLIMAILLALAPVMLVQDKMGIFASMRSSM RLTWANMRLVAPAVLSWLLAKTLLLLFASSFAALTPEIGAVLANTLSNLISAILLIYLFR LYMLIRQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What genetic and structural features characterize the yciC gene and protein?

The yciC gene in E. coli strains like ATCC 8739 has been identified as CEH00_RS07655 . While specific information on the O139:H28 strain is limited in current literature, comparative genomic analyses suggest conservation of this gene across various E. coli strains. The protein is classified under the "Uncharacterised protein family UPF0259" in the InterPro database and is annotated as a "hypothetical protein; Provisional" in the Conserved Domain Database (CDD) .

Structurally, analysis of the amino acid sequence reveals multiple hydrophobic regions that likely form transmembrane domains. The protein contains approximately 220 amino acids, with several membrane-spanning segments interspersed with hydrophilic regions that may form loops inside or outside the cell membrane.

How does the classification of yciC compare to other membrane proteins?

In the broader context of membrane protein classification, membrane proteins are categorized based on their topology and interaction with the lipid bilayer. Classification systems use various computational approaches to predict membrane protein types:

Classification MethodAccuracyTechnique
Decision Tree (DT)69.81%Feature extraction from membrane proteins
Network-based approach66.78%Uses protein-protein interaction networks
Shortest path approach54.97%Connectivity analysis in protein networks
SVM-based modules76.6%Uses amino acid composition
SVM-based modules77.8%Uses dipeptide composition
PSI-BLAST73.3%Similarity-based search against annotated proteins

The classification of yciC as a membrane protein would utilize these computational approaches, with the most accurate methods likely being those based on SVM and dipeptide composition analysis.

What are the essential components of a true experimental design for studying yciC protein function?

A true experimental design for studying yciC protein function should incorporate the following essential components:

  • Investigator manipulation of the independent variable (IV): This involves systematically varying conditions such as gene expression levels, mutations in the yciC gene, or environmental factors that might influence protein function .

  • Control of the study situation: This includes maintaining consistent protocols, settings, and using appropriate control groups to isolate the effects of the experimental manipulation .

  • Random assignment: Participants (in this case, bacterial cultures or experimental units) should be randomly assigned to different treatment conditions using procedures such as random number generators .

A pretest-posttest control group design would be particularly effective, where measurements are taken before and after the experimental manipulation, with both experimental and control groups . This approach maximizes internal validity and strengthens causal inferences about yciC function.

GroupPretestTreatmentPosttest
ExperimentalBaseline measurementyciC manipulationPost-treatment measurement
ControlBaseline measurementNo manipulation or vector-onlyPost-treatment measurement

The random assignment of bacterial cultures to groups is crucial for ensuring that the experimental and control groups are similar in all respects except for the treatment variable, thus allowing confident attribution of observed differences to the experimental manipulation .

How should researchers address potential validity threats when studying membrane proteins like yciC?

When studying membrane proteins like yciC, researchers must address both internal and external validity threats:

Internal Validity Threats:

  • Selection bias: Use random assignment of bacterial cultures to experimental conditions to ensure groups are equivalent at baseline .

  • History and maturation effects: Control for external events and natural changes over time by including appropriate temporal controls and maintaining consistent experimental conditions.

  • Instrumentation issues: Standardize measurement protocols and calibrate equipment regularly to ensure consistent data collection.

  • Experimental mortality: Account for potential loss of samples during the experiment and oversample initially to maintain statistical power.

External Validity Threats:

  • Population generalizability: Test findings across multiple E. coli strains to ensure results are not strain-specific.

  • Ecological validity: Validate in vitro findings with in vivo models where possible to confirm biological relevance.

  • Contextual effects: Examine protein function under various physiologically relevant conditions that bacteria might encounter.

Researchers should implement a systematic approach to control extraneous variables through careful experimental setting design, standardized instructions, rigorous sampling techniques, proper assignment methods, consistent observation techniques, validated measurement approaches, and the use of research designs with appropriate control groups .

What methodological approaches are most effective for recombinant expression and purification of yciC?

For optimal recombinant expression and purification of yciC, researchers should consider the following methodological approaches:

Expression System Selection:

  • Host strain: E. coli strains specifically designed for membrane protein expression, such as C41(DE3) or C43(DE3), which are better tolerate membrane protein overexpression.

  • Expression vector: Vectors with tunable promoters (such as the arabinose-inducible pBAD system) allow for precise control of expression levels, reducing potential toxicity.

  • Fusion tags: Addition of solubility-enhancing tags (MBP, SUMO) or affinity tags (His, GST) can improve both expression and purification efficiency.

Optimization Parameters:

  • Growth conditions: Lower temperatures (16-25°C) often improve proper folding of membrane proteins.

  • Induction parameters: Low inducer concentrations and extended expression times typically yield better results for membrane proteins.

  • Media composition: Supplementation with specific lipids or osmolytes can stabilize membrane proteins during expression.

Purification Strategy:

  • Membrane isolation: Gentle cell disruption methods followed by differential centrifugation to separate membrane fractions.

  • Solubilization: Screening of detergents (such as DDM, LDAO, or CHAPS) for optimal protein extraction from membranes.

  • Chromatography: Multi-step purification typically involving affinity chromatography followed by size exclusion chromatography.

This methodological approach draws upon established protocols for membrane protein production while acknowledging the specific challenges associated with uncharacterized proteins like yciC.

How can researchers elucidate the structure-function relationship of yciC?

Elucidating the structure-function relationship of yciC requires an integrated approach combining computational, biochemical, and biophysical methods:

Computational Analysis:

  • Homology modeling: Generate structural models based on related proteins with known structures.

  • Molecular dynamics simulations: Predict protein behavior in membrane environments and identify potentially important residues.

  • Conservation analysis: Identify evolutionarily conserved regions that may be functionally important.

Mutagenesis Studies:

  • Alanine scanning: Systematically replace amino acids with alanine to identify critical residues.

  • Domain swapping: Exchange domains between yciC and related proteins to map functional regions.

  • Site-directed mutagenesis: Target specific residues predicted to be important from computational analyses.

Structural Determination:

  • X-ray crystallography: Though challenging for membrane proteins, detergent-solubilized or lipidic cubic phase crystallization may be attempted.

  • Cryo-electron microscopy: Increasingly powerful for membrane protein structure determination, especially for larger complexes.

  • NMR spectroscopy: Particularly useful for dynamic regions or smaller fragments of the protein.

The challenge in this approach lies in connecting structural information to functional data, especially for an uncharacterized protein. Researchers should develop functional assays based on predictions from structural studies and iteratively refine both structural models and functional hypotheses.

What approaches can be used to identify potential interaction partners of yciC?

Identifying interaction partners of yciC requires multiple complementary approaches:

In vivo Methods:

  • Bacterial two-hybrid systems: Modified for membrane protein analysis to detect direct protein-protein interactions.

  • Co-immunoprecipitation: Using antibodies against yciC or attached tags to pull down protein complexes.

  • Cross-linking mass spectrometry: Chemical cross-linking of neighboring proteins followed by mass spectrometry identification.

In vitro Methods:

  • Pull-down assays: Using purified yciC as bait to capture interacting proteins from cell lysates.

  • Surface plasmon resonance: Measuring direct binding between yciC and candidate interactors.

  • Isothermal titration calorimetry: Quantifying binding affinities and thermodynamic parameters of interactions.

Computational Predictions:

  • Genomic context analysis: Examining gene neighborhood and operonic structure to predict functional associations.

  • Co-expression analysis: Identifying genes with similar expression patterns across conditions.

  • Protein-protein interaction network analysis: Using existing network data to predict novel interactions based on shared partners.

Each method has strengths and limitations, so a combination of approaches is recommended. Validation of predicted interactions through multiple independent methods increases confidence in the results.

How can multi-label classification methods improve our understanding of yciC function?

Multi-label classification approaches offer powerful tools for predicting multiple functional aspects of uncharacterized proteins like yciC:

Decision Tree Classification:
Research has shown that decision tree (DT) classifiers can achieve an accuracy of 69.81% for membrane protein classification, outperforming network-based approaches (66.78%) and shortest path methods (54.97%) . This approach extracts essential features from membrane protein datasets that serve as input for the classification algorithm.

Implementation Strategy:

  • Feature extraction: Identify key features from the yciC sequence and structural predictions, including hydrophobicity patterns, amino acid composition, and predicted secondary structure elements.

  • Training set selection: Utilize well-characterized membrane proteins with known functions as training data.

  • Algorithm application: Apply the DT classifier to predict potential functions, subcellular localizations, and interaction properties.

  • Validation: Confirm predictions through experimental approaches targeting the specific predicted functions.

The advantage of multi-label classification is that it can simultaneously predict multiple functional attributes of yciC, providing a more holistic understanding of the protein's potential roles in cellular processes. Decision tree methods are particularly valuable as they provide interpretable rules that can guide experimental design, unlike "black box" approaches.

How should contradictory experimental results regarding yciC function be analyzed?

Contradictory experimental results regarding yciC function require systematic analysis through the following framework:

Source Identification:

  • Methodological differences: Compare experimental protocols, including expression systems, purification methods, and assay conditions.

  • Strain variations: Determine if different E. coli strains were used, as strain-specific differences might explain contradictory results.

  • Environmental conditions: Analyze whether differences in growth conditions, media composition, or stress factors could explain discrepancies.

Reconciliation Strategies:

  • Meta-analysis approach: Systematically combine data from multiple studies to identify patterns and sources of heterogeneity.

  • Reproducibility testing: Attempt to replicate key experiments under standardized conditions.

  • Collaborator engagement: Establish collaborations between labs reporting contradictory results to directly compare methods.

  • Contextual hypothesis development: Formulate new hypotheses that can explain seemingly contradictory results (e.g., context-dependent functions).

When analyzing contradictory results, researchers should apply the criteria for establishing causality: temporal precedence, covariation of cause and effect, and elimination of alternative explanations . This framework helps determine whether contradictions stem from methodological differences or reflect genuine biological complexity.

What statistical approaches should be applied to functional studies of membrane proteins like yciC?

Statistical analysis of membrane protein functional studies requires specialized approaches:

Experimental Design Considerations:

  • Power analysis: Determine appropriate sample sizes based on expected effect sizes and variability in membrane protein studies.

  • Blocking factors: Control for batch effects in protein preparation and experimental conditions.

  • Repeated measures designs: Account for measurements taken on the same protein preparations under different conditions.

Statistical Methods:

  • For comparing multiple conditions: ANOVA with appropriate post-hoc tests, accounting for multiple comparisons using methods like Bonferroni correction or false discovery rate (FDR) control.

  • For dose-response relationships: Regression models with appropriate transformations for non-linear responses.

  • For high-dimensional data: Principal component analysis, clustering methods, and machine learning approaches for pattern recognition.

  • For time-series data: Mixed-effects models to account for temporal correlation and biological variability.

When reporting results, researchers should include measures of effect size in addition to p-values, as statistical significance alone does not indicate biological significance. Transparent reporting of all statistical analyses, including assumptions testing and justification for statistical choices, is essential for reproducibility.

How can researchers effectively compare yciC across different E. coli strains?

Effective cross-strain comparison of yciC requires a systematic approach:

Sequence-Based Analysis:

  • Multiple sequence alignment: Align yciC sequences from different E. coli strains to identify conserved and variable regions.

  • Phylogenetic analysis: Construct phylogenetic trees to understand evolutionary relationships and selection pressures.

  • SNP and indel identification: Catalog strain-specific variations that might impact protein function.

Functional Comparison:

  • Standardized expression systems: Express yciC variants from different strains in the same host background to isolate protein-specific effects.

  • Comparative phenotyping: Assess the impact of yciC knockout and complementation across multiple strains.

  • Cross-complementation experiments: Determine if yciC from one strain can functionally replace that of another strain.

Data Integration:

  • Correlation analysis: Identify relationships between sequence variations and functional differences.

  • Structure-function mapping: Map strain-specific variations onto structural models to predict functional implications.

  • Contextual analysis: Consider strain-specific genetic background, typical environmental niches, and physiological adaptations when interpreting differences.

This comparative approach can reveal insights into the evolutionary adaptation of yciC function and provide clues about its role in strain-specific phenotypes, particularly between pathogenic and non-pathogenic E. coli variants.

What emerging technologies will advance our understanding of uncharacterized membrane proteins like yciC?

Several emerging technologies show promise for advancing research on uncharacterized membrane proteins:

Advanced Structural Technologies:

  • Cryo-electron microscopy (cryo-EM): Continuing improvements in resolution allow structure determination without crystallization.

  • Integrative structural biology: Combining multiple data sources (cryo-EM, crosslinking mass spectrometry, molecular dynamics) to build comprehensive structural models.

  • AI-based structure prediction: Methods like AlphaFold2 increasingly accurate for membrane protein structure prediction.

Functional Genomics Approaches:

  • CRISPR interference/activation: Precise modulation of gene expression to study dose-dependent effects.

  • High-throughput phenotyping: Automated systems for measuring multiple phenotypes across thousands of conditions.

  • Single-cell analysis: Examining cell-to-cell variability in yciC expression and function.

Systems Biology Integration:

  • Multi-omics data integration: Combining transcriptomics, proteomics, metabolomics, and phenotypic data to place yciC in broader cellular context.

  • Network perturbation analysis: Systematic measurement of network responses to yciC modulation.

  • Mathematical modeling: Development of predictive models of membrane protein function within cellular systems.

These technologies, particularly when used in combination, promise to overcome traditional barriers to studying uncharacterized membrane proteins and accelerate our understanding of proteins like yciC.

How might understanding yciC function contribute to broader knowledge of bacterial membrane biology?

Understanding yciC function has several potential implications for bacterial membrane biology:

Fundamental Knowledge Advancement:

  • Novel membrane protein families: Characterization of UPF0259 proteins could reveal new functional classes of membrane proteins.

  • Membrane organization principles: Insights into how uncharacterized proteins contribute to membrane domain formation and maintenance.

  • Protein-lipid interactions: New understanding of how specific lipid environments influence membrane protein function.

Comparative Bacterial Physiology:

  • Species-specific adaptations: Insights into how membrane protein functions evolve to support different ecological niches.

  • Core vs. accessory functions: Identification of conserved membrane processes across bacterial species.

  • Stress response mechanisms: Understanding how membrane proteome composition responds to environmental challenges.

Characterizing yciC may reveal new paradigms in membrane protein function, particularly for proteins without obvious enzymatic or transport activities that nonetheless play important structural or regulatory roles in bacterial membranes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.