Recombinant Escherichia coli O139:H28 UPF0761 membrane protein yihY (yihY)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

The recombinant YihY protein is derived from the E. coli O139:H28 strain (ETEC) and produced with an N-terminal His tag for purification. Key specifications include:

PropertyDetails
UniProt IDA7ZU91 (strain-specific)
Amino Acid Sequence290 residues (Full-length: 1–290 aa)
Molecular Weight~33 kDa (calculated)
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

The sequence includes a hydrophobic core typical of membrane proteins, with five predicted transmembrane helices forming a hydrophilic groove critical for interaction with substrates .

Production and Purification

Recombinant YihY is produced in E. coli systems with optimized protocols:

ParameterConditions
Expression HostE. coli BL21(DE3) or similar strains
InductionIPTG (concentration unspecified)
Purification MethodImmobilized metal affinity chromatography (IMAC) via His tag
StabilityStable for weeks at 4°C in 50% glycerol; avoid freeze-thaw cycles

A rapid stability screening strategy using gel filtration chromatography has been adapted from YidC purification workflows, enabling high-yield production (>1 mg/mL) .

Research Applications

Recombinant YihY is utilized in diverse experimental contexts:

ApplicationUse Case
Structural BiologyCrystallography and cryo-EM studies of membrane protein insertion
Diagnostic DevelopmentAntigen in ELISA for pathogen-specific antibody detection
Functional StudiesInvestigating membrane protein folding and complex assembly

Challenges and Future Directions

Current limitations include:

  • Functional Ambiguity: YihY’s exact biological role remains uncharacterized compared to YidC.

  • Structural Gaps: No high-resolution structure of YihY exists, necessitating cryo-EM or X-ray crystallography studies.

Future research should prioritize substrate identification and mechanistic studies to elucidate YihY’s role in E. coli membrane dynamics.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference for customers.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yihY; EcE24377A_4409; UPF0761 membrane protein YihY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Escherichia coli O139:H28 (strain E24377A / ETEC)
Target Names
yihY
Target Protein Sequence
MLKTIQDKARHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAA FPMFSDVSIQLRHFIFANFLPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSI DSALNTIWRSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEDDEP
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the recommended storage and handling conditions for recombinant yihY protein?

Recombinant yihY protein should be stored in Tris-based buffer containing 50% glycerol at -20°C for regular storage, with -80°C recommended for extended storage periods . For experimental work, it's advisable to create working aliquots stored at 4°C that should be used within one week to maintain protein integrity. Repeated freeze-thaw cycles should be avoided as they can compromise protein structure and function. When handling the protein, maintain sterile conditions and use appropriate buffers compatible with membrane protein stability to prevent denaturation.

What expression systems are typically used for producing recombinant yihY protein?

While specific information on yihY expression systems is limited in the provided search results, membrane proteins in E. coli are typically expressed using specialized bacterial expression systems. Based on established protocols for similar membrane proteins, recombinant yihY would likely be expressed in E. coli strains optimized for membrane protein production, such as C41(DE3), C43(DE3), or Lemo21(DE3). These expression hosts often incorporate modifications that accommodate the potentially toxic effects of overexpressing membrane proteins. The expression region for yihY spans positions 1-290, suggesting the full-length protein is used in recombinant systems .

How might yihY interact with the bacterial membrane insertion machinery?

Based on research on bacterial membrane protein insertion, yihY likely interacts with the membrane insertion machinery in E. coli. Membrane proteins typically undergo co-translational insertion via the SecYEG translocon and/or the YidC insertase pathway . The YidC protein mediates membrane protein insertion either independently as an insertase or in concert with the SecY complex . For membrane proteins like yihY, insertion might occur through the holo-translocon (HTL) complex, which combines SecYEG-SecDF-YajC-YidC components to facilitate efficient integration into the lipid bilayer . This complex would position the transmembrane domains of yihY into the membrane while properly orienting hydrophilic regions toward the cytoplasm or periplasm.

What computational methods can be applied to predict yihY protein-protein interactions?

Advanced computational methods for predicting protein-protein interactions for membrane proteins like yihY include evolutionary co-variation analysis, which has been successfully applied to other membrane proteins such as YidC . This approach identifies residue pairs that co-evolve, suggesting potential interaction sites. The methodology involves:

  • Construction of multiple sequence alignments of the target protein

  • Computation of direct evolutionary couplings between residue pairs

  • Analysis of diagonal and anti-diagonal patterns of coupling coefficients to identify parallel or anti-parallel helix-helix interactions

  • Calculation of interaction probabilities for each helix-helix contact

These methods can help predict functional partners of yihY and inform experimental designs to validate these interactions.

How does the UPF0761 family compare to other membrane protein families in E. coli?

The UPF0761 family represents one of many membrane protein families in E. coli. Unlike well-characterized membrane proteins such as the deoxycholate-binding periplasmic protein YgiS (which functions in deoxycholate transport and affects bacterial growth in the presence of bile acids) or YidC (which plays a critical role in membrane protein insertion) , the UPF0761 family remains less characterized.

Comparative analysis table of selected E. coli membrane protein families:

Protein FamilyRepresentative MemberKnown FunctionStructural FeaturesInteraction Partners
UPF0761YihYUncharacterizedMultiple transmembrane domainsUnknown
Deoxycholate transportersYgiSDeoxycholate transportPeriplasmic binding proteinLikely transport system components
Protein insertasesYidCMembrane protein insertion5 conserved transmembrane domains with distinctive arrangementRibosome, SecYEG complex
SecY complexSecYProtein secretion and insertionCentral translocation channelSecE, SecG, SecDF-YajC, YidC

This comparison highlights the gaps in our understanding of yihY compared to better-characterized membrane protein families.

What purification strategies are most effective for isolating recombinant yihY protein?

Purification of recombinant yihY, like other membrane proteins, requires specialized approaches due to its hydrophobic nature. An effective purification strategy would involve:

  • Membrane isolation: Following expression, bacterial cells are lysed and membranes containing yihY are isolated through differential centrifugation.

  • Solubilization: Membranes are solubilized using detergents compatible with membrane protein stability (commonly used detergents include n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin).

  • Affinity chromatography: If the recombinant yihY contains an affinity tag (such as His-tag), immobilized metal affinity chromatography (IMAC) can be used for initial purification.

  • Size exclusion chromatography: As a final purification step to separate aggregates and obtain homogeneous protein preparations.

  • Quality assessment: SDS-PAGE analysis with >90% purity confirmation, similar to standards used for other recombinant E. coli membrane proteins .

Throughout purification, it's critical to maintain the protein in appropriate buffer conditions that preserve its native conformation and prevent aggregation.

What reconstitution methods can be used to study yihY function in artificial membrane systems?

To study yihY function in artificial membrane systems, researchers can employ several reconstitution methods:

  • Proteoliposome reconstitution: Purified yihY can be incorporated into liposomes composed of E. coli lipid extracts or defined lipid mixtures. This typically involves:

    • Mixing detergent-solubilized protein with lipids

    • Controlled detergent removal via dialysis, Bio-Beads, or dilution

    • Verification of incorporation using density gradient centrifugation

  • Nanodiscs: For single-molecule studies or structural analyses, yihY can be reconstituted into nanodiscs formed by membrane scaffold proteins and phospholipids.

  • Functional validation: Activity assays specific to the predicted function of yihY would need to be developed. If yihY is involved in transport, this might include measuring substrate uptake or membrane potential changes in the reconstituted system.

The methods used for HTL complex reconstitution, which demonstrates both protein secretion and membrane protein insertion capabilities, could serve as a model for yihY functional studies .

What techniques can be used to determine the topology and membrane orientation of yihY?

Determining the topology and membrane orientation of yihY requires multiple complementary approaches:

  • Cysteine scanning mutagenesis: Systematic introduction of cysteine residues throughout yihY followed by accessibility studies using membrane-permeable and impermeable thiol-reactive reagents.

  • Protease protection assays: Proteoliposomes containing yihY are treated with proteases; protected fragments indicate membrane-embedded regions while digested regions are exposed to the aqueous environment.

  • Fluorescence spectroscopy: Introduction of fluorescent probes at specific sites to monitor membrane penetration and protein dynamics.

  • Cryo-electron microscopy: For higher-resolution structural information, especially if yihY forms complexes with other proteins. Similar approaches have been used successfully to visualize YidC-ribosome complexes during membrane protein insertion .

  • Evolutionary co-variation analysis: Computational methods like those used for YidC structure prediction can provide initial models of transmembrane helix arrangements .

The combination of these techniques would generate a comprehensive model of yihY's membrane topology and orientation.

What methods are suitable for identifying potential binding partners or substrates of yihY?

To identify potential binding partners or substrates of yihY, researchers should consider these methodological approaches:

  • Co-immunoprecipitation with cross-linking: Chemical cross-linking followed by pull-down assays can capture transient protein-protein interactions that might be disrupted during standard purification procedures.

  • Bacterial two-hybrid systems: Modified for membrane proteins, these genetic screens can identify potential interaction partners in vivo.

  • Proximity-based labeling: Techniques such as BioID or APEX, where yihY is fused to a biotin ligase or peroxidase, can identify nearby proteins in the native cellular environment.

  • Lipidomic analysis: If yihY potentially interacts with specific lipids, mass spectrometry-based lipidomic approaches can identify enriched lipid species co-purifying with the protein.

  • Comparative genomic analysis: Examination of gene neighborhoods and co-occurrence patterns across bacterial species can suggest functional associations.

The integration of multiple approaches would provide the most comprehensive identification of yihY's functional partners.

How can I assess the impact of mutations in the yihY gene on bacterial phenotypes?

Assessing the impact of yihY mutations on bacterial phenotypes requires systematic approaches:

  • Generation of deletion mutants: Creation of clean yihY deletion strains using lambda Red recombination or CRISPR-Cas techniques.

  • Complementation studies: Re-introduction of wild-type or mutant yihY variants to confirm phenotypic changes are specifically due to yihY alterations.

  • Growth phenotype characterization:

    • Growth curve analysis under various conditions (temperature, pH, osmolarity)

    • Stress response testing (oxidative stress, antimicrobial compounds)

    • Membrane integrity assays (permeability to dyes, resistance to detergents)

  • Comparative proteomics and transcriptomics: Analysis of changes in protein expression or gene transcription in yihY mutants compared to wild-type.

  • Metabolite profiling: Detection of alterations in cellular metabolites that might indicate disrupted pathways.

Similar approaches have been used to characterize other E. coli membrane proteins, such as YgiS, where deletion mutants exhibited altered growth in the presence of deoxycholate .

What strategies can be employed to develop antibodies specific to yihY for research applications?

Developing specific antibodies against yihY requires careful consideration of its membrane protein nature:

  • Antigen design options:

    • Recombinant full-length protein: Challenging due to hydrophobicity but provides recognition of native conformations

    • Synthetic peptides: Selection of hydrophilic loops or termini that are predicted to be accessible

    • Fusion proteins: Expression of hydrophilic domains fused to carrier proteins

  • Immunization protocol:

    • Multiple small doses with appropriate adjuvants

    • Longer immunization schedules to improve affinity maturation

    • Use of various animal models to obtain diverse antibody repertoires

  • Screening methodology:

    • ELISA against different forms of the antigen

    • Western blotting against native and denatured protein

    • Immunofluorescence to confirm recognition of the protein in its native cellular context

  • Validation steps:

    • Testing antibody specificity against yihY knockout strains

    • Cross-reactivity assessment with related proteins

    • Epitope mapping to confirm target binding sites

The resulting antibodies would enable various applications including immunolocalization, co-immunoprecipitation, and protein quantification.

How can structural studies of yihY be approached given the challenges of membrane protein crystallography?

Structural studies of yihY face the typical challenges of membrane protein research, but several methodologies can be employed:

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis for higher-order complexes

    • Electron crystallography for 2D crystals

    • Tomography for in situ structural studies

  • Nuclear Magnetic Resonance (NMR) spectroscopy:

    • Solution NMR with detergent-solubilized protein

    • Solid-state NMR with reconstituted proteoliposomes

    • Selective isotope labeling to focus on specific regions

  • X-ray crystallography optimizations:

    • Lipidic cubic phase crystallization

    • Use of fusion partners like T4 lysozyme to increase hydrophilic surface area

    • Antibody fragment co-crystallization to stabilize flexible regions

  • Computational approaches:

    • Homology modeling based on related structures

    • Evolutionary coupling analysis as demonstrated for YidC

    • Molecular dynamics simulations to assess conformational dynamics

A combination of these methods would provide complementary structural information, as demonstrated in the structural characterization of YidC, where evolutionary co-variation analysis and molecular dynamics simulations were used to build a structural model that was later validated by crystallography .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.