Recombinant Escherichia coli O139:H28 Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
zntB; EcE24377A_1556; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Escherichia coli O139:H28 (strain E24377A / ETEC)
Target Names
zntB
Target Protein Sequence
MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ FGFSIFCILLVVLIGGVALWLHRSKWL
Uniprot No.

Target Background

Function

Mediates the efflux of zinc ions.

Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of ZntB in E. coli and how does it differ from other metal transporters?

ZntB in E. coli functions as a symmetrical pentameric membrane protein belonging to the CorA metal ion transporter (MIT) family. Unlike its homolog CorA, which can form an asymmetrical state in the absence of Mg²⁺, ZntB maintains its symmetrical pentameric structure even after extensive treatment with EDTA to remove divalent cations . The cryo-electron microscopy structure of full-length ZntB from E. coli reveals a cytoplasmic domain with strong positive electrostatic surface potential, which differs significantly from the more negative potential observed in isolated domains of Salmonella typhimurium ZntB .

What is the primary physiological role of ZntB in bacterial zinc homeostasis?

Contrary to earlier assumptions that classified ZntB as a zinc exporter, detailed biochemical studies with reconstituted ZntB in liposomes demonstrate that ZntB primarily functions as a zinc importer rather than an exporter . It mediates Zn²⁺ uptake that is stimulated by a pH gradient across the membrane, functioning through a Zn²⁺/H⁺ co-transport mechanism . This clarifies ZntB's role in bacterial zinc homeostasis as part of a controlled system of zinc import-export alongside other zinc transporters, including ZupT, ZnuABC, ZntA, and YiiP .

How does ZntB transport zinc across the bacterial membrane?

ZntB mediates zinc uptake through a proton-coupled transport mechanism. Transport assays with purified ZntB reconstituted into liposomes demonstrate that zinc uptake is enhanced by a pH gradient with the lumen of the liposomes more basic than the outside, while uptake is suppressed in the presence of a reverse pH gradient . This evidence suggests that zinc transport is driven by the pH gradient, with protons being co-transported with Zn²⁺.

ConditionRelative Transport RateEffect of FCCP Addition
No pH gradientBaselineNo effect
pH gradient (basic inside)EnhancedEfflux of accumulated Zn²⁺
pH gradient (acidic inside)SuppressedStimulated additional uptake
Na⁺ gradientNo stimulationNot applicable

What experimental approaches can be used to measure ZntB-mediated zinc transport?

Several complementary approaches have been successfully employed to characterize ZntB transport activity:

  • Radiolabeled zinc uptake assays: Using ⁶⁵Zn²⁺ with ZntB reconstituted into liposomes to directly measure transport rates under various conditions .

  • Fluorescent transport assays: Employing zinc-specific fluorescent dyes like fluozin-1 encapsulated in liposomes to monitor zinc uptake in real-time .

  • pH-dependent transport measurement: Using pH-sensitive fluorophores such as 9-amino-6-chloro-2-methoxyacridine (ACMA) to detect proton movement coupled to zinc transport .

  • Isothermal titration calorimetry (ITC): To determine binding affinities and thermodynamic parameters of zinc interaction with ZntB .

What are the optimal conditions for expressing recombinant ZntB from E. coli O139:H28?

For effective expression of recombinant ZntB from E. coli O139:H28, researchers should consider:

  • Expression system selection: E. coli expression systems with tightly controlled inducible promoters (e.g., T7 or arabinose-inducible systems) are preferable to avoid toxicity issues associated with membrane protein overexpression.

  • Host strain considerations: BL21(DE3) derivatives with mutations in proteases or strains specifically designed for membrane protein expression may yield better results.

  • Induction conditions: Lower temperatures (16-25°C) and extended induction times often improve the yield of properly folded membrane proteins.

  • Solubilization and purification: Screening multiple detergents is crucial for maintaining the pentameric structure and function during purification.

What approaches can be used to verify the functional integrity of purified recombinant ZntB?

To ensure purified ZntB retains its native function, researchers should implement multiple validation approaches:

  • Size exclusion chromatography: To confirm the pentameric assembly of purified ZntB.

  • Zinc binding assays: Using ITC to verify zinc binding capacity and affinity.

  • Proteoliposome reconstitution: Incorporating purified ZntB into liposomes for transport assays.

  • Activity measurements: Using radioactive ⁶⁵Zn²⁺ uptake or fluorescent zinc indicators (e.g., fluozin-1) to confirm transport function .

  • pH gradient effects: Verifying that transport activity responds appropriately to pH gradients as expected for the proton-coupled mechanism .

How is ZntB expression regulated in response to environmental zinc levels?

While specific regulation in E. coli O139:H28 is not detailed in the provided information, studies in related organisms provide valuable insights:

  • In Cupriavidus metallidurans, ZntB expression is downregulated in the presence of high concentrations of Zn²⁺, Cd²⁺, and Cu²⁺, consistent with its role as an importer .

  • In Agrobacterium tumefaciens, ZntB expression was not induced by treatments with Zn²⁺ in concentrations ranging from 100 to 750 μM .

  • These regulatory patterns align with ZntB's function as a zinc importer, as cells would logically reduce importer expression when zinc is abundant.

How does prolonged zinc exposure affect bacterial physiology and ZntB function?

Extended exposure to zinc compounds can dramatically alter bacterial physiology:

  • An extended treatment with ZnO for 40 sub-culturings led to bacterial resistance to aminoglycosides, cephalosporins, and sulfonamides, while treatment with ZnONPs for 40 sub-culturings led to elevated MIC to chloramphenicol only .

  • Zinc exposure causes significant changes in cell transcripts and proteins with roles in antibiotic response, heat stress, growth regulation, cell shape, and biofilm formation .

  • Cells exposed to zinc treatments were thicker and had retarded growth at elevated temperatures .

  • Importantly, zinc withdrawal reversed most phenotypic changes, suggesting adaptive rather than permanent genetic changes .

How does the transport mechanism of ZntB differ from that of CorA channels?

Despite belonging to the same protein family, ZntB and CorA utilize fundamentally different transport mechanisms:

  • Symmetry maintenance: Unlike CorA channels that form a highly asymmetrical state upon depletion of divalent cations, ZntB maintains its symmetrical pentameric state even after extensive EDTA treatment .

  • Transport type: ZntB functions as a secondary active transporter coupling zinc movement to a proton gradient, whereas CorA functions as a channel for magnesium .

  • Conformational changes: The transport mechanism in ZntB likely involves more subtle conformational changes within the symmetrical framework, possibly including helical rotation of TM1 which contains conserved basic and acidic residues on adjacent faces .

  • Physiological relevance: The differences may reflect adaptation to distinct physiological conditions - while intracellular Mg²⁺ concentrations are relatively high (0.5-1mM), free Zn²⁺ levels are extremely low (pM-fM range) .

What structural transitions occur during the ZntB transport cycle?

Comparison of the full-length E. coli ZntB structure (obtained in the absence of Zn²⁺) with the structure of the soluble domain of StZntB (crystallized in the presence of Zn²⁺) reveals critical insights:

  • Dramatic differences in surface potentials between the structures suggest zinc-dependent conformational changes .

  • The shape of the internal pore differs between the two forms, possibly representing different conformational states in the transport cycle .

  • The charge inversion of the pore surface between symmetrical states might be caused by helical rotation of TM1, which bears conserved basic and acidic residues on adjacent faces .

Experimental EvidenceObservationImplication for Transport Mechanism
⁶⁵Zn²⁺ uptake with pH gradientEnhanced uptake with basic insideTransport driven by pH gradient
Effect of proton ionophore (FCCP)Reversed zinc accumulationConfirms H⁺-dependent transport
ACMA fluorescenceZn²⁺ uptake generated pH gradientConfirms coupled H⁺-Zn²⁺ transport
Surface potential comparisonDramatic differences between Zn²⁺-bound and free statesSuggests conformational changes during transport

What role might ZntB play in bacterial pathogenesis during host infection?

While direct evidence linking ZntB to pathogenesis in E. coli O139:H28 is not detailed in the provided information, several important considerations emerge:

  • Zinc homeostasis represents a critical battleground in host-pathogen interactions, with hosts attempting to either sequester zinc to reduce bacterial virulence or elevate zinc concentrations to suppress pathogens .

  • Bacteria counter these host defenses through regulated import and export systems, suggesting ZntB may play a role in bacterial adaptation to zinc-limited environments within the host .

  • For E. coli O139:H28 specifically, which produces enterotoxins and surface antigens associated with pathogenicity , ZntB's contribution to maintaining appropriate intracellular zinc levels could potentially support virulence factor production and expression.

How does zinc exposure affect antibiotic susceptibility in E. coli and what mechanisms might be involved?

Extended exposure to zinc compounds can significantly alter antibiotic susceptibility:

TreatmentAntibiotic Resistance Outcome
ZnO for 40 sub-culturingsResistance to aminoglycosides, cephalosporins, and sulfonamides
ZnONPs for 40 sub-culturingsElevated MIC to chloramphenicol only
ZnO for 20 sub-culturings followed by 20 without zincMost phenotypic changes reversed

These changes likely involve multiple mechanisms:

  • Zinc exposure dramatically alters cell transcripts and proteins involved in antibiotic response .

  • Changes in cell shape (thicker cells) after zinc exposure may affect antibiotic penetration .

  • The reversibility of these changes following zinc withdrawal suggests adaptive responses rather than stable genetic mutations .

Understanding these zinc-induced adaptations may provide insights into bacterial responses to metal-containing antimicrobials and environmental stressors.

What are the key unresolved questions regarding ZntB structure and function?

Several critical questions remain for future research:

  • Detailed transport mechanism: What are the precise conformational changes that occur during zinc transport, and how is proton coupling achieved at the molecular level?

  • Substrate specificity: What structural features determine ZntB's selectivity for zinc over other divalent cations?

  • Strain-specific variations: Do sequence variations in ZntB across different E. coli strains, including O139:H28, affect transport properties or regulatory responses?

  • Integration with other zinc homeostasis systems: How is ZntB activity coordinated with other zinc transporters to maintain optimal intracellular zinc levels?

  • Therapeutic potential: Could ZntB be a viable target for novel antimicrobials that disrupt bacterial zinc homeostasis?

What emerging technologies might advance our understanding of ZntB function?

Several cutting-edge approaches hold promise for future ZntB research:

  • Cryo-EM studies of different conformational states: Capturing ZntB in various states of the transport cycle could provide crucial insights into the molecular mechanism.

  • Single-molecule FRET: To monitor real-time conformational changes during transport.

  • Genetically encoded zinc sensors: For monitoring ZntB-mediated zinc transport in living cells.

  • Advanced computer simulations: Molecular dynamics simulations could reveal details of zinc and proton movement through the transporter.

  • Gene editing technologies: CRISPR-Cas9 approaches could enable precise manipulation of ZntB in various E. coli strains to assess physiological roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.