Recombinant Escherichia coli O139:H28 Zinc transporter ZupT (zupT)

What is ZupT and what is its primary function in E. coli?

ZupT is a low-affinity zinc importer belonging to the ZIP (Zrt-, Irt-like Protein) family of metal transporters. Its primary function is to facilitate zinc uptake under various environmental conditions, particularly when zinc is not severely limited. The protein consists of 257 amino acids in E. coli O139:H28 (strain E24377A/ETEC) and contains multiple transmembrane domains that form a channel for zinc transport across the bacterial membrane .

Unlike the high-affinity ZnuABC transporter system, ZupT operates constitutively at a basal level in standard conditions, though its expression can be modulated by zinc availability. This transporter plays a critical role in maintaining zinc homeostasis, which is essential for numerous cellular processes including protein structure stabilization, enzymatic activity, and gene expression regulation .

How does ZupT differ structurally and functionally from the high-affinity ZnuABC transporter?

ZupT and ZnuABC represent two distinct zinc acquisition systems in bacteria that differ in several key aspects:

While ZnuABC is a three-component system that operates primarily under severe zinc limitation, ZupT functions as a single transmembrane protein that contributes to zinc uptake across a wider range of environmental conditions. These systems work synergistically, with ZupT providing a baseline zinc import capability that is complemented by the more specialized, high-affinity ZnuABC system when zinc becomes scarce .

What is the amino acid sequence of the ZupT protein in E. coli O139:H28, and what are the key functional domains?

The full amino acid sequence of the ZupT protein from E. coli O139:H28 (strain E24377A/ETEC) is:

MSVPLILTILAGAATFIGAFLGVLGQKPSNRLLAFS LGFAAGIMLLISLMEMLPAALAAE GMSPVLGYGMFIFGLLGYFGLDRMLPHAHPQDLMQKSVQPLPKSIKRTAILLTLGISLHN FPEGIATFVTASSNLELGFGIALAVALHNIPEGLAVAGPVYAATGSKRTAILWAGISGL AEILGGVLAWLILGSMISPVVMAAIMAAVAGIMVALSVDELMPLAKEIDPNNNPSYGVLCG MSVMGFSLVLLQTAGIG

Key functional domains include:

• Multiple transmembrane helices that form the zinc transport channel

• Metal-binding motifs containing histidine and aspartate residues

• Cytoplasmic loops involved in conformational changes during transport

• Signal sequences that determine membrane topology

The protein's structure facilitates the coordinated binding and release of zinc ions as they move from the periplasmic space into the cytoplasm, with specific residues serving as coordination sites for the metal.

What are the optimal methods for expressing and purifying recombinant ZupT for in vitro studies?

For optimal expression and purification of recombinant ZupT, the following methodological approach is recommended:

Expression System:

• E. coli BL21(DE3) or similar expression strains are preferred hosts

• Expression vectors containing T7 or tac promoters with appropriate affinity tags (His6, FLAG, or Strep-tag)

• Codon optimization for E. coli if expressing heterologous ZupT variants

• Induction with 0.1-0.5 mM IPTG at lower temperatures (16-25°C) to enhance proper folding

Purification Protocol:

• Cell lysis using mild detergents (n-dodecyl-β-D-maltoside or CHAPS) to solubilize membrane proteins

• Immobilized metal affinity chromatography (IMAC) for His-tagged constructs

• Size exclusion chromatography to improve purity and remove aggregates

• Optional: Ion exchange chromatography as a polishing step

Buffer Considerations:

• Inclusion of 5-10% glycerol for stability

• Addition of zinc (1-5 μM) to maintain protein structure

• pH range of 7.0-8.0 to maintain protein stability

• Presence of reducing agents (1-5 mM DTT or β-mercaptoethanol) to prevent oxidation

The purified protein should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage, as recommended for the recombinant ZupT protein .

What experimental approaches can be used to study ZupT-mediated zinc transport in bacterial cells?

Several experimental approaches can be employed to study ZupT-mediated zinc transport:

1. Genetic Approaches:

• Construction of zupT knockout strains and complementation studies

• Creation of zupT/znuABC double mutants to assess synergistic effects

• Site-directed mutagenesis of key residues to determine structure-function relationships

2. Growth Assays:

• Cultivation in defined media with controlled zinc concentrations

• Growth curves in the presence of metal chelators (EDTA, TPEN)

• Use of agarose plates (instead of agar) which have intrinsic zinc-sequestering properties

• Competitive growth assays between wild-type and mutant strains

3. Direct Measurement of Zinc Transport:

• Use of radioactive 65Zn to measure uptake kinetics

• Fluorescent zinc probes (FluoZin-3, Zinpyr-1) to monitor intracellular zinc levels

• ICP-MS (Inductively Coupled Plasma Mass Spectrometry) quantification of cellular zinc content

4. Expression Analysis:

• Transcriptional fusions (zupT-lacZ) to monitor gene expression under various conditions

• qRT-PCR to quantify zupT mRNA levels

• Western blotting to detect ZupT protein expression with specific antibodies

5. Functional Assays:

• Hydrogen peroxide sensitivity tests to assess the role of ZupT in oxidative stress resistance

• Measurement of zinc-dependent enzyme activities as indicators of intracellular zinc status

• In vivo colonization assays to evaluate the role of ZupT in pathogenesis

These approaches have been successfully applied to study ZupT function, particularly in comparative analyses with znuABC mutants under zinc-limiting conditions .

How can researchers effectively generate and validate zupT knockout mutants?

The generation and validation of zupT knockout mutants involves several critical steps:

Generation Methods:

• Lambda Red Recombineering

  • Design primers with 40-50 bp homology to zupT flanking regions

  • Amplify antibiotic resistance cassette (e.g., kanamycin)

  • Transform PCR product into E. coli expressing Lambda Red proteins

  • Select transformants on antibiotic-containing media

• CRISPR-Cas9 System

  • Design sgRNA targeting zupT gene

  • Create donor template with desired modifications

  • Co-transform sgRNA and donor template

  • Screen for successful editing events

• Allelic Exchange

  • Clone zupT flanking regions into a suicide vector

  • Introduce vector into target strain and select for single crossover

  • Counter-select for double crossover events

  • Screen for gene deletion

Validation Approaches:

• Molecular Confirmation

  • PCR verification using primers flanking the deleted region

  • Sequencing of the modified locus to confirm precise deletion

  • RT-PCR or Northern blotting to confirm absence of zupT transcript

• Phenotypic Confirmation

  • Growth assays in zinc-limited media showing impaired growth compared to wild-type

  • Rescue of the growth defect by zinc supplementation

  • Complementation tests using plasmid-expressed zupT

  • Increased sensitivity to oxidative stress (H2O2 challenge)

• Functional Validation

  • Measurement of reduced zinc uptake using 65Zn or fluorescent zinc probes

  • Assessment of zinc-dependent enzyme activities

  • Analysis of intracellular zinc content by ICP-MS

A comprehensive validation strategy should include both molecular and functional assessments to conclusively demonstrate the specific role of ZupT in the observed phenotypes .

How does ZupT expression change under different environmental conditions?

ZupT expression responds to environmental conditions, particularly metal availability, though the response is more nuanced than that of the ZnuABC system:

Response to Zinc Limitation:

• Studies with zupT-lacZ transcriptional fusions have shown that zupT expression increases under zinc-limiting conditions induced by metal chelators like EDTA

• This induction is more pronounced in a znuABC mutant background, suggesting compensatory regulation

• The addition of zinc to chelator-treated cultures restores zupT expression to basal levels

Basal Expression:

• Unlike some other zinc transporters, ZupT maintains a constitutive basal expression level even in zinc-replete media like LB

• This constitutive expression ensures a baseline zinc uptake capacity regardless of environmental conditions

Response to Other Metals:

• While zinc supplementation can reduce zupT expression, the addition of other metals may have different effects, indicating metal-specific regulatory mechanisms

• The presence of competing metals in the environment may influence zupT expression through indirect mechanisms

Growth Phase Dependence:

• ZupT expression patterns may vary depending on the bacterial growth phase, with potential differences between exponential and stationary phases

Experimental evidence from Salmonella studies demonstrates that zupT transcriptional activity is significantly increased in response to EDTA treatment and is restored to basal levels by zinc supplementation, indicating that while constitutively expressed at a baseline level, zupT expression can be modulated by zinc availability .

What is the relationship between ZupT and oxidative stress resistance in bacteria?

ZupT plays a significant role in bacterial resistance to oxidative stress through several mechanisms:

Direct Experimental Evidence:

• Studies in Salmonella have shown that zupT mutants exhibit increased susceptibility to H2O2-mediated killing compared to wild-type strains

• The double znuABC zupT mutant displays hypersensitivity to hydrogen peroxide, indicating a synergistic effect

• Supplementation with zinc restores resistance to oxidative damage in these mutant strains to levels comparable to wild-type

Mechanistic Relationships:

• Zinc as a Cofactor for Antioxidant Enzymes

  • ZupT contributes to the metallation of zinc-dependent enzymes involved in oxidative stress response, such as:

    • Cu/Zn superoxide dismutase (SodC)

    • PerR transcriptional regulator

    • Thiol peroxidases

• Protection of Protein Thiols

  • Zinc imported by ZupT helps protect protein thiols from oxidation

  • Proper zinc metallation prevents formation of reactive oxygen species through improper metal binding

• Maintenance of Redox Homeostasis

  • Appropriate zinc levels supported by ZupT activity help maintain cellular redox balance

  • Zinc deficiency can lead to disruption of iron-sulfur clusters and increased free iron, which promotes oxidative damage

The quantitative impact of ZupT on oxidative stress resistance has been demonstrated in experiments where survival after H2O2 challenge was significantly reduced in zupT mutants (approximately 60-70% survival) compared to wild-type (>90% survival), with even greater reduction in znuABC zupT double mutants (<30% survival) .

How does ZupT cooperate with the ZnuABC system to maintain zinc homeostasis?

ZupT and ZnuABC operate in a complementary manner to ensure zinc homeostasis across various environmental conditions:

Functional Synergy:

Experimental Evidence of Cooperation:

• Growth Studies

  • Single zupT mutants show modest growth defects in zinc-limited media

  • znuABC mutants display significant growth impairment under zinc limitation

  • Double znuABC zupT mutants exhibit severe growth defects that cannot be rescued by manganese or iron supplementation, only by zinc

• Metal Uptake Analysis

  • ZupT contributes to baseline zinc uptake across various conditions

  • ZnuABC becomes essential when environmental zinc is severely limited

  • The combined action of both systems ensures optimal zinc acquisition

• Regulatory Interaction

  • When ZnuABC is absent, zupT expression is further induced to partially compensate

  • This suggests regulatory cross-talk between these systems, possibly mediated by zinc-sensing transcription factors

• Physiological Impact

  • The presence of both systems provides robustness to the bacterial zinc uptake network

  • ZupT's lower substrate specificity may allow for uptake of other divalent metals when necessary

The critical nature of this cooperation is demonstrated by the nearly complete growth inhibition of znuABC zupT double mutants in zinc-limiting conditions, while single mutants maintain some growth capacity. This indicates that these two transporters represent the primary zinc acquisition systems in Enterobacteriaceae, with minimal functional redundancy from other transporters .

What role does ZupT play in bacterial virulence and host colonization?

ZupT contributes significantly to bacterial virulence and host colonization through several mechanisms:

Evidence from Infection Models:

• Studies in Salmonella have shown that zupT mutant strains exhibit attenuated virulence during systemic infections in Nramp1+/+ mice

• Competition experiments between znuABC and znuABC zupT mutants revealed that ZupT contributes to metal uptake in vivo, independent of the presence of a functional Nramp1 transporter

• The importance of ZupT becomes particularly evident in environments where zinc is limited, such as within host tissues during infection

Mechanisms of Contribution to Virulence:

• Zinc Acquisition in Host Environments

  • Host nutritional immunity restricts zinc availability as a defense mechanism

  • ZupT helps bacteria overcome this limitation by facilitating zinc uptake

  • This is crucial for establishing infection in zinc-limited host compartments

• Resistance to Host Defense Mechanisms

  • ZupT's role in oxidative stress resistance helps bacteria survive respiratory burst from phagocytes

  • Proper zinc homeostasis maintained by ZupT supports bacterial defense against antimicrobial peptides

• Support of Virulence Factor Expression

  • Zinc is a cofactor for numerous virulence-associated proteins

  • ZupT ensures sufficient zinc availability for the function of these factors

  • This includes zinc-dependent toxins, adhesins, and invasion proteins

• Adaptation to Changing Host Environments

  • During infection, bacteria encounter varying metal concentrations

  • ZupT provides flexible zinc uptake capability across different host niches

  • This adaptation is crucial for successful colonization and persistence

The contribution of ZupT to pathogenesis may be particularly relevant in specific host compartments where zinc limitation is a prominent feature of nutritional immunity, but where the limitation is not severe enough to exclusively require the high-affinity ZnuABC system .

How do serovars of E. coli containing ZupT interact with host immune responses?

E. coli serovars containing ZupT interact with host immune responses in complex ways that involve both evasion and modulation of immunity:

Interactions with Innate Immunity:

• Neutrophil Response

  • ZupT-mediated zinc acquisition helps bacteria resist neutrophil killing mechanisms

  • Zinc-sufficient bacteria can better withstand neutrophil oxidative burst

  • E. coli O139:H28 and other pathogenic serovars use zinc-dependent mechanisms to resist neutrophil extracellular traps (NETs)

• Macrophage Interactions

  • Host macrophages reduce zinc availability in phagosomes as part of nutritional immunity

  • ZupT helps bacteria counter this zinc limitation within phagocytic cells

  • In Nramp1+/+ mice, which have enhanced ability to limit metal availability in macrophages, ZupT's contribution to virulence becomes more significant

• Epithelial Barrier Function

  • Zinc-dependent adhesins and invasion factors supported by ZupT activity facilitate interaction with epithelial barriers

  • E. coli O139 serovars utilize zinc-requiring proteins for attachment and colonization

Modulation of Inflammatory Responses:

• Zinc homeostasis affects bacterial LPS structure and immunogenicity

• ZupT-facilitated zinc uptake may influence the production of immunomodulatory factors

• Proper zinc metallation of bacterial surface structures can alter pattern recognition receptor activation

Evasion Strategies:

• ZupT-dependent metallation of superoxide dismutases helps neutralize reactive oxygen species

• Zinc-dependent proteases supported by ZupT activity may degrade host antimicrobial peptides

• Properly metallated virulence factors can interfere with complement activation and antibody recognition

In porcine infection models, E. coli O139 has been identified among the most commonly reported pathogenic serogroups, suggesting successful adaptation to host immune defenses in these animals. The presence of virulence genes in O139 isolates, coupled with functional zinc homeostasis systems including ZupT, likely contributes to this success in colonization and infection .

What is the significance of ZupT in E. coli O139:H28 compared to other pathogenic E. coli strains?

The significance of ZupT in E. coli O139:H28 compared to other pathogenic E. coli strains encompasses several important aspects:

Serogroup-Specific Characteristics:

• E. coli O139:H28 belongs to the enterotoxigenic E. coli (ETEC) pathotype

• This serogroup is among the porcine pathogenic E. coli serogroups (including O8, O108, O138, O139, O141, O147, O149, and O157) most commonly reported in clinical isolates

• O139 has been specifically associated with edema disease in swine, indicating specialized virulence mechanisms

Comparative ZupT Function:

• While the fundamental role of ZupT in zinc uptake is conserved across E. coli strains, its relative importance may vary

• In O139:H28, ZupT may have evolved specific adaptations to function optimally in its preferred host environments

• Sequence variations in ZupT may affect metal specificity, transport kinetics, or regulatory responses

Association with Virulence Profiles:

• E. coli O139 strains often carry specific virulence genes that may have functional relationships with zinc homeostasis

• Studies have shown that hemolytic activity, which is common in O139 isolates, does not always correlate with the presence of virulence genes

• This suggests complex interactions between zinc homeostasis systems like ZupT and other virulence determinants

Host Adaptation Considerations:

• ZupT in E. coli O139:H28 may be optimized for zinc acquisition in porcine hosts

• This specialization could involve adaptations to counter porcine-specific zinc sequestration mechanisms

• The regulatory networks controlling zupT expression might respond differently to host-specific signals in O139:H28 compared to other pathotypes

Serotyping studies have shown that E. coli O139:K91 is among the common pathogenic serogroups in swine, suggesting that the combination of O139 antigen with specific virulence factors and functional metal acquisition systems like ZupT contributes to the pathogenic potential of these strains in particular host environments .

What structural biology approaches can reveal the zinc binding and transport mechanism of ZupT?

Advanced structural biology approaches can provide critical insights into ZupT's zinc binding and transport mechanisms:

X-ray Crystallography:

• Challenges: Membrane proteins like ZupT are notoriously difficult to crystallize due to their hydrophobic nature

• Solutions:

  • Lipidic cubic phase (LCP) crystallization

  • Use of crystallization chaperones (antibody fragments)

  • Fusion with crystallization-promoting proteins (e.g., T4 lysozyme)

• Expected outcomes: High-resolution structures revealing zinc coordination sites, transmembrane topology, and potential conformational changes

Cryo-Electron Microscopy:

• Single-particle cryo-EM can achieve near-atomic resolution for membrane proteins without crystallization

• Sample preparation strategies:

  • Reconstitution into nanodiscs or amphipols

  • Detergent screening for optimal protein stability

• Data collection at multiple conformational states can reveal the transport mechanism

NMR Spectroscopy:

• Solution NMR for studying:

  • Dynamics of metal binding

  • Conformational changes upon zinc binding

  • Interaction with lipid environments

• Solid-state NMR to study ZupT in native-like membrane environments

Computational Approaches:

• Molecular dynamics simulations to model:

  • Zinc passage through the transport channel

  • Conformational changes during transport cycle

  • Interaction with membrane lipids

• Homology modeling based on related ZIP transporters with known structures

Functional Studies Coupled with Structural Analysis:

• Site-directed mutagenesis of predicted zinc-binding residues

• Accessibility studies using cysteine-modifying reagents

• Cross-linking experiments to capture transport intermediates

• Metal selectivity studies to identify key residues involved in zinc specificity

The combination of these approaches would allow researchers to determine how zinc ions are coordinated, the pathway through which zinc traverses the membrane, and the conformational changes that drive transport. This would provide a mechanistic understanding of how ZupT functions as a low-affinity zinc transporter and how it differs from the high-affinity ZnuABC system .

What are the regulatory mechanisms controlling zupT expression in different bacterial species?

The regulatory mechanisms controlling zupT expression exhibit both conserved and species-specific features across different bacteria:

Zinc-Responsive Regulation:

• In Salmonella, evidence shows that zupT expression increases under zinc-limiting conditions (induced by EDTA) and decreases when zinc is added back to the medium

• This regulation is more pronounced in a znuABC mutant background, suggesting compensatory upregulation

• The response appears to be metal-specific, as zinc supplementation can restore basal expression levels in metal-depleted conditions

Known and Predicted Regulatory Factors:

• Zur (Zinc Uptake Regulator)

  • This zinc-sensing repressor is the primary regulator of znuABC

  • While classical Zur binding sites may be absent in zupT promoters of some species, atypical or low-affinity binding may occur

  • Evidence suggests indirect Zur effects on zupT expression

• Other Metal-Responsive Regulators

  • Fur (Ferric Uptake Regulator) may influence zupT in some contexts

  • Other metalloregulatory proteins may cross-talk with zupT regulation

  • Two-component systems responding to membrane stress may regulate zupT

• General Stress Response Factors

  • RpoS (σS) may regulate zupT under certain stress conditions

  • OxyR/SoxRS might link oxidative stress to zupT expression

Species-Specific Differences:

• In E. coli, zupT has been reported to be constitutively expressed, with limited regulation

• In Salmonella, zupT shows more pronounced regulation in response to zinc availability

• Plant-associated bacteria may have evolved different regulatory mechanisms for zupT expression in response to plant-specific signals

Experimental Evidence of Regulation:

• Transcriptional fusions between the zupT promoter and reporter genes like lacZ have demonstrated:

  • Basal expression in rich media

  • Induction by metal chelators

  • Suppression by zinc supplementation

  • Enhanced expression in znuABC mutant backgrounds

These diverse regulatory mechanisms allow bacteria to fine-tune zinc uptake via ZupT in response to changing environmental conditions, complementing the more tightly regulated high-affinity ZnuABC system .

How can structural and functional insights into ZupT be applied to develop novel antimicrobial strategies?

Structural and functional insights into ZupT can inform novel antimicrobial strategies through several innovative approaches:

1. Direct Inhibition Strategies:

• Small molecule inhibitors designed to block the zinc transport channel

• Compounds that interfere with conformational changes required for transport

• Competitive inhibitors that bind to metal coordination sites

• Allosteric modulators that lock ZupT in inactive conformations

2. Dual-Targeting Approaches:

• Simultaneous inhibition of both ZupT and ZnuABC to completely block zinc uptake

• Combination therapies targeting zinc homeostasis alongside other essential pathways

• Metal-chelating compounds with selectivity for bacterial over host zinc pools

3. Virulence Attenuation:

• Since ZupT contributes to oxidative stress resistance, targeting it could sensitize bacteria to host immune defenses

• Inhibiting ZupT could reduce bacterial fitness during infection without direct killing

• This approach may reduce selective pressure and slow resistance development

4. Trojan Horse Strategies:

• Design of zinc mimetics that are transported by ZupT but toxic to bacterial cells

• Development of ZupT-dependent prodrugs that become activated inside bacteria

• Creation of conjugates between ZupT substrates and existing antibiotics

5. Structure-Based Vaccine Design:

• Identification of exposed epitopes in ZupT for vaccine development

• Generation of attenuated strains with modified ZupT for live vaccine candidates

• Design of antibodies that bind and block ZupT function

6. Diagnostic Applications:

• Development of tests that detect ZupT expression as a marker of active infection

• Creation of imaging agents that bind to bacterial zinc transporters

• Use of ZupT polymorphisms for strain typing and epidemiological studies

Considerations for Therapeutic Development:

• The challenge of targeting a low-affinity transporter with redundant functions

• The need for selectivity against bacterial versus human ZIP transporters

• Potential for resistance development through compensatory mechanisms

• Species-specific variations in ZupT structure that may affect inhibitor binding

The potential effectiveness of these strategies is supported by evidence that zinc homeostasis is critical for bacterial pathogenesis. For instance, znuABC zupT double mutants show severely impaired growth and increased sensitivity to oxidative stress, suggesting that comprehensive targeting of zinc uptake systems could significantly compromise bacterial fitness during infection .

What are the current contradictions or knowledge gaps in our understanding of ZupT function?

Several significant contradictions and knowledge gaps exist in our current understanding of ZupT function:

Regulatory Discrepancies:

• While some studies report constitutive expression of zupT in E. coli, others (particularly in Salmonella) demonstrate clear zinc-responsive regulation

• The exact transcription factors and regulatory elements controlling zupT expression remain incompletely characterized

• The apparent differences in regulation between bacterial species require further investigation

Metal Specificity Questions:

• The precise metal selectivity profile of ZupT remains incompletely defined

• While primarily described as a zinc transporter, ZupT may transport other divalent metals, but the relative affinities and physiological relevance are not fully established

• The structural basis for metal selectivity is not well understood

Functional Redundancy Puzzles:

• The extent of functional overlap between ZupT and other metal transporters beyond ZnuABC is unclear

• The conditions under which these potentially redundant systems become relevant are not fully mapped

• The evolutionary pressures maintaining multiple zinc uptake systems with different affinities remain speculative

Structural Knowledge Limitations:

• No high-resolution structure of ZupT has been published

• The precise zinc binding sites and transport mechanism remain theoretical

• How ZupT's structure differs from eukaryotic ZIP transporters is not well established

Virulence Contribution Contradictions:

• The contribution of ZupT to virulence varies across infection models and bacterial species

• The relationship between zinc transport activity and specific virulence phenotypes is incompletely understood

• Whether ZupT has virulence-related functions beyond zinc transport remains an open question

Methodological Challenges:

Addressing these knowledge gaps will require integrated approaches combining structural biology, genetics, biochemistry, and infection models to build a more complete understanding of ZupT's role in bacterial physiology and pathogenesis .

How do environmental factors influence the interplay between ZupT and other metal transporters?

Environmental factors significantly influence the complex interplay between ZupT and other metal transporters, affecting their relative contributions to bacterial metal homeostasis:

Metal Availability Effects:

pH Influence:

• Acidic environments may alter metal speciation and availability

• Protonation states of metal-coordinating residues in ZupT may be affected

• The relative efficiency of ZupT versus ZnuABC may shift with pH changes

• In host compartments with varying pH, different transporters may dominate

Oxidative Stress Conditions:

• Oxidative stress increases bacterial zinc demand for antioxidant enzymes

• ZupT's contribution to oxidative stress resistance becomes more critical

• Oxidation may affect metal-binding sites in transporters, altering their function

• The interplay between iron and zinc transport systems changes under oxidative conditions

Host-Derived Factors:

• Calprotectin and other host zinc-sequestering proteins create severe zinc limitation

• Inflammatory environments alter metal availability and transporter requirements

• Antimicrobial peptides may interact differently with various metal transport systems

• Host cell type (e.g., epithelial versus phagocytic) presents different metal landscapes

Bacterial Growth Phase:

• Exponential versus stationary phase alters metal requirements and transporter expression

• Biofilm formation creates microenvironments with distinct metal gradients

• Persistent or dormant states may rely on different metal acquisition hierarchies

Experimental evidence in Salmonella demonstrates this complex interplay, with zupT expression showing increased importance in znuABC mutants under zinc limitation, and the double znuABC zupT mutant exhibiting synergistic growth defects that cannot be rescued by other metals. This indicates environment-specific roles for these transporters that shift based on metal availability and other conditions .

What emerging technologies or approaches will advance our understanding of ZupT biology?

Several emerging technologies and approaches hold promise for advancing our understanding of ZupT biology:

1. Advanced Structural Biology Techniques:

• Cryo-electron tomography to visualize ZupT in native membrane environments

• Micro-electron diffraction (MicroED) for structural analysis of small ZupT crystals

• Time-resolved structural methods to capture transport intermediates

• Serial femtosecond crystallography using X-ray free electron lasers

2. Single-Molecule Approaches:

• Single-molecule FRET to track conformational changes during transport

• High-speed atomic force microscopy to observe ZupT dynamics in membranes

• Nanopore recording to measure individual zinc transport events

• Single-molecule tracking in live cells to observe ZupT localization and dynamics

3. Advanced Genetic Tools:

• CRISPR interference for precise temporal control of zupT expression

• Multiplexed CRISPR screening to identify genetic interactions

• Base editing for precise amino acid substitutions without selection markers

• In vivo directed evolution to probe ZupT structure-function relationships

4. Innovative Imaging Methods:

• Genetically encoded zinc sensors for real-time monitoring in live cells

• Super-resolution microscopy to study ZupT localization patterns

• Correlative light and electron microscopy to link function and structure

• Mass spectrometry imaging to map metal distribution in bacterial cells

5. Systems Biology Approaches:

• Multi-omics integration (transcriptomics, proteomics, metallomics)

• Flux analysis of zinc movement through bacterial cells

• Network modeling of metal homeostasis systems

• Machine learning to predict metal transport dynamics

6. Advanced In Vivo Models:

• Engineered tissue models that recapitulate host-pathogen interactions

• Intravital microscopy to observe bacterial metal acquisition during infection

• Organoid cultures to study metal competition in complex environments

• Animal models with altered zinc homeostasis to probe transporter importance

7. Computational Methods:

• Enhanced molecular dynamics simulations of transport processes

• Quantum mechanical/molecular mechanical (QM/MM) calculations of zinc coordination

• Deep learning approaches to predict transporter-substrate interactions

• Artificial intelligence-driven drug design targeting ZupT

These technologies will help address fundamental questions about ZupT's structure, transport mechanism, regulation, and role in bacterial physiology and pathogenesis. The integration of data from these diverse approaches will provide a comprehensive understanding of ZupT biology and its potential as a target for antimicrobial development .