Recombinant Escherichia coli O157:H7 4-hydroxybenzoate octaprenyltransferase (ubiA)
Shipped with Ice Packs 
In Stock 
Description
Biochemical Properties and Catalytic Mechanism
UbiA is an intramembrane prenyltransferase requiring Mg²⁺ for optimal activity . Key functional insights include:
Mutational studies confirm that ubiA knockout strains lack enzymatic activity, resulting in ubiquinone deficiency . Complementation with yeast COQ2 (a homolog) restores ubiquinone biosynthesis, demonstrating functional conservation .
Functional and Pathogenic Relevance
-
Ubiquinone Biosynthesis: UbiA is indispensable for electron transport in E. coli respiration .
-
Pathogenicity: E. coli O157:H7 strains carrying ubiA also harbor virulence genes (e.g., stx1, stx2, eaeA) , though UbiA itself is not directly linked to toxin production.
-
Disease Models: Mutations in human UBIAD1 (a UbiA homolog) cause Schnyder corneal dystrophy, underscoring the enzyme’s conserved role in lipid metabolism .
Applications in Research
Product Specs
Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your requests to the best of our ability.
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your requests to the best of our ability.
Lead Time
Delivery time
may vary depending on the purchasing method and location. For specific delivery timeframes, kindly consult your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please inform us in advance. Additional fees will apply.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ubiA; ECH74115_5521; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Target Names
ubiA
Target Protein Sequence
MEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMR
AAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVLISFLLVLTLNTMTIL
LSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWA
VAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGVLALMAIIGELNGLGWGYY
WSILVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF
Uniprot No.
Target Background
Function
Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. Facilitates the second step in the final reaction sequence of ubiquinone-8 (UQ-8) biosynthesis. This step involves the condensation of the polyisoprenoid side chain with PHB, resulting in the formation of the first membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.
Database Links
KEGG: ecf:ECH74115_5521
Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
