Recombinant Escherichia coli O157:H7 ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Escherichia coli O157:H7 ATP Synthase Subunit b (atpF)

Recombinant E. coli O157:H7 ATP synthase subunit b (atpF) is a transmembrane protein expressed in vitro using bacterial systems (typically E. coli) to study its structural, functional, and pathological roles. This subunit is a critical component of the F₀ sector of the ATP synthase complex, forming part of the peripheral stalk that connects the F₁ (catalytic) and F₀ (proton-translocating) domains . In pathogenic strains like E. coli O157:H7, atpF is encoded by the atpF gene (locus ECH74115_5172) and plays a central role in bioenergetics and pathogen-host interactions .

ATP Synthase Activity

Subunit b forms a homodimeric peripheral stalk that:

  • Transmits rotational energy: Couples proton translocation across the F₀ sector to ATP synthesis in F₁ .

  • Regulates conformational changes: Cryo-EM studies reveal distinct conformations (e.g., "down" and "half-up" states) depending on ATP/ADP binding, influencing enzyme activity .

  • Interacts with subunits: Crosslinking studies identify proximity to a, α, β, and δ subunits .

Pathogenicity-Associated Roles

In E. coli O157:H7, atpF is linked to:

  • Adhesion and aggregation: Proteomic studies suggest atpF may contribute to bacterial adhesion to host cells, though direct evidence remains limited .

  • Stress responses: Transcriptomic profiling under environmental stressors (e.g., light, acid) shows altered expression of ATP synthase genes, though atpF-specific responses are not explicitly detailed .

Recombinant Expression and Purification

  • Expression system: E. coli in vitro systems with N-terminal 10xHis-tag for nickel affinity chromatography .

  • Storage: Tris-based buffer with 50% glycerol at -20°C .

Table 2: Recombinant atpF Production Parameters

ParameterValue/DescriptionReferences
Expression systemE. coli with His-tag
Purification methodNickel affinity chromatography
Yield50 µg (typical batch)
StabilityAvoid repeated freeze-thaw cycles

Applications in Research

  • Structural studies: NMR and cryo-EM analyses to elucidate conformational dynamics .

  • Immunoassays: ELISA kits for detecting atpF-specific antibodies or antigens .

  • Vaccine development: Potential target for pathogen-specific therapies, though experimental validation is pending .

Pathogenicity and Host Interaction

  • Adhesion studies: Bacterial ghosts expressing atpF showed reduced mortality in animal models, suggesting atpF may modulate virulence .

  • Gene expression: Under stress (e.g., 465 nm light), ATP synthase genes are downregulated, potentially impacting bioenergetics in E. coli O157:H7 .

Table 4: Transcriptomic Responses of atpF-Related Genes

ConditionGene Expression TrendBiological ContextReferences
465 nm illuminationDownregulatedOxidative stress response
Lactic acid stressUpregulatedAcid tolerance response

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpF; ECH74115_5172; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Target Names
atpF
Target Protein Sequence
MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREEL RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembrane catalytic core; and the F0 domain, containing the membrane proton channel. These domains are linked by a central and a peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This subunit is a component of the F0 channel and forms part of the peripheral stalk, connecting F1 and F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the structural and functional significance of ATP synthase subunit b in E. coli O157:H7?

ATP synthase subunit b, encoded by the atpF gene, serves as a critical component of the F1Fo ATP synthase complex in E. coli O157:H7. This protein exists as a dimer and forms part of the peripheral stalk that connects the catalytic F1 domain to the membrane-embedded Fo domain. The b subunit prevents rotation of the F1 component during ATP synthesis.

Crystal structure analysis has revealed that the b subunit (residues 62-122) forms a monomeric alpha helix with a length of approximately 90 Å. In the functional ATP synthase complex, it exists as a dimer with distinctive structural properties:

  • An extremely elongated structure with a frictional ratio of 1.60

  • A maximal dimension of 95 Å

  • A radius of gyration of 27 Å

These characteristics are consistent with an alpha-helical coiled-coil structure that provides the rigidity necessary for its function as a stator in the ATP synthase complex.

How has ATP synthase subunit b been modified for experimental studies?

Researchers have developed various experimental approaches to study ATP synthase subunit b:

  • Site-directed mutagenesis: Creating point mutations to study structure-function relationships. For example, in studies of the β subunit (which interacts with subunit b), researchers generated nonphosphorylatable (T262A) and phosphomimetic (T262E) analogs to investigate functional consequences of phosphorylation .

  • Recombinant expression systems: Various expression vectors and host strains have been optimized for the production of ATP synthase components, including:

    • T7 promoter systems for high-level expression

    • Arabinose-inducible promoters for more controlled expression

    • Low copy number plasmids to reduce protein aggregation

  • Domain-focused studies: Researchers often focus on specific domains of the protein, such as the dimerization domain (residues 62-122), which has been crystallized and characterized by small-angle X-ray scattering (SAXS) .

How is the expression of atpF regulated in E. coli O157:H7?

The regulation of atpF expression in E. coli O157:H7 involves multiple mechanisms:

  • Transcriptional regulation: The atpF gene is part of the atp operon, which is regulated by environmental factors including:

    • Oxygen availability

    • Growth phase

    • Nutrient availability

    • Energy status of the cell

  • Post-translational modifications: Phosphorylation events can significantly alter ATP synthase function. Studies on the β subunit have demonstrated that phosphomimetic mutations at specific sites (like T262E) can abolish ATPase activity, while nonphosphorylatable mutations (T262A) maintain normal activity levels .

  • Stress response: Under certain stress conditions, including those that trigger the viable but nonculturable (VBNC) state, the expression and activity of ATP synthase components can be altered. For instance, RNA-Seq transcriptomic analysis has revealed complex regulatory networks affecting ATP synthase during transition to the VBNC state .

What experimental design considerations are crucial for studying recombinant atpF expression?

When designing experiments to study recombinant atpF expression, researchers should consider the following methodological framework:

Table 1: Key Experimental Design Considerations for atpF Studies

Design ElementOptionsConsiderations
Experimental approachBetween-subjects designEach sample is tested under only one condition, avoiding carryover effects but requiring more samples
Within-subjects designEach sample is tested under multiple conditions, providing statistical power but risking carryover effects
Control conditionsNo-treatment controlEssential baseline for comparison
Vector-only controlControls for effects of the expression vector
Inactive mutant controlTests specificity of observed effects
RandomizationRandom assignmentCritical for eliminating systematic differences between experimental groups
Variable controlConstant variablesTemperature, media composition, growth phase must be standardized
Independent variablesTypically includes expression conditions, mutations, or environmental stressors
Dependent variablesATP synthase activity, protein expression levels, bacterial growth, etc.

Additionally, when designing experiments involving recombinant E. coli O157:H7 ATP synthase subunit b, it is essential to establish a clear relationship between cause and effect. Experimental research is particularly valuable when time is an important factor in establishing this relationship, when there is an invariable behavior between cause and effect, or when the researcher wishes to understand the importance of the cause and effect .

What expression systems are most effective for recombinant atpF production?

The selection of an appropriate expression system is critical for successful production of recombinant ATP synthase subunit b. Several approaches have been evaluated:

Table 2: Expression Systems for Recombinant atpF Production

Studies have shown that the choice of promoter significantly impacts the success of recombinant protein expression. While T7 is a popular and strong promoter, alternative moderately strong or weak promoters may be beneficial to express recombinant proteins that are prone to inclusion body formation. Examples include the tac, araC, and synthetic trc promoters .

What are the most reliable methods for detecting and quantifying the expression of recombinant atpF?

Several complementary approaches can be used to detect and quantify recombinant ATP synthase subunit b expression:

  • Western blotting: Provides specific detection of the protein using antibodies against the b subunit or fusion tags. Studies have demonstrated successful detection of heterologously expressed recombinant OmpF using this technique .

  • Blue Native PAGE (BN-PAGE): Essential for analyzing the assembly state of ATP synthase complexes. This technique has been used to show that depletion of ATP synthase components can lead to decreased levels of F1Fo dimer and monomer, while increasing the levels of free F1 moiety .

  • Enzymatic activity assays: Measuring ATP synthase function through:

    • ATP hydrolysis rate (ATPase activity)

    • ATP synthesis coupled to a luminescence-based detection system

    • Proton-pumping activity using pH-sensitive fluorescent dyes

  • Time-Gated Surface-Enhanced Raman spectroscopy (TG-SERS): This advanced technique allows evaluation of protein production and correct folding within living E. coli cells during cultivation by suppressing the fluorescence signal from biomolecules in bacteria and culture media .

  • Quantitative proteomics: SILAC-MS approaches can determine the consequences of protein depletion on the mitochondrial proteome, as demonstrated in studies of ATP synthase components .

How can researchers optimize purification protocols for recombinant atpF?

Purification of recombinant ATP synthase subunit b requires careful optimization due to its membrane-associated nature and tendency to form dimers. A systematic purification protocol should include:

  • Cell lysis optimization:

    • Buffer composition: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol

    • Inclusion of detergents for membrane protein extraction (0.5-1% n-dodecyl-β-D-maltoside)

    • Addition of protease inhibitors to prevent degradation

  • Initial purification:

    • Affinity chromatography using fusion tags (His, MBP, GST)

    • For His-tagged proteins, immobilized metal affinity chromatography with Ni-NTA resin is effective

  • Secondary purification:

    • Ion exchange chromatography based on the theoretical pI of ATP synthase subunit b

    • Size exclusion chromatography to separate monomeric and dimeric forms

  • Quality assessment:

    • SDS-PAGE with Coomassie staining to assess purity

    • Western blotting to confirm identity

    • Mass spectrometry for molecular weight verification

    • Dynamic light scattering to assess homogeneity

For membrane proteins like ATP synthase subunit b, special consideration should be given to maintaining the protein in a native-like environment. This may involve the use of amphipathic polymers or nanodiscs to stabilize the protein structure during and after purification.

What role does ATP synthase play in the viable but nonculturable (VBNC) state of E. coli O157:H7?

The viable but nonculturable (VBNC) state of E. coli O157:H7 has significant public health implications, as demonstrated by outbreaks where VBNC cells were the source of infection despite low culturable cell counts. The ATP synthase complex appears to play an important role in this phenomenon:

RNA-Seq transcriptomic analysis combined with iTRAQ proteomic methods have revealed that during VBNC state formation:

The atpF gene product may be particularly relevant to VBNC state formation due to its role in energy production and its location in the cell membrane, which undergoes significant changes during transition to the VBNC state. High-pressure CO2 (HPCD) has been shown to induce the transition of E. coli O157:H7 into the VBNC state , possibly through effects on membrane-associated proteins including ATP synthase components.

How can knowledge of ATP synthase subunit b structure be applied to developing targeted antimicrobials?

The unique structural features of ATP synthase subunit b present opportunities for developing targeted antimicrobials against E. coli O157:H7:

  • Dimerization interface targeting: The b subunit dimer is essential for ATP synthase function. Small molecules or peptides designed to disrupt this interaction could specifically inhibit ATP synthesis. Crystal structure data showing the b subunit (residues 62-122) forms a monomeric alpha helix with a length of approximately 90 Å provides valuable information for structure-based drug design .

  • Species-specific regions: Comparative analysis of ATP synthase subunit b across species reveals varying degrees of conservation. While the b subunit shows high conservation among E. coli strains, specific variations could be targeted to develop narrow-spectrum antimicrobials that spare beneficial bacteria.

  • Essential function: ATP synthase is critical for cellular energy production, making it an excellent antimicrobial target. In T. brucei, knockdown of a highly diverged ATP synthase subunit b homolog (Tb927.8.3070) caused growth retardation by day 2 post-induction and decreased levels of F1Fo dimer and monomer complexes , demonstrating the essential nature of this protein.

  • Structure-based approaches: The crystal structure of the b subunit dimerization domain and SAXS data indicating an extremely elongated structure consistent with an alpha-helical coiled-coil provide a foundation for rational drug design approaches .

Developing antimicrobials targeting ATP synthase subunit b would require careful consideration of:

  • Structural conservation across bacterial species to achieve desired specificity

  • Essential regions for protein function to minimize resistance development

  • Accessibility of the target site for small molecule binding

How can researchers overcome inclusion body formation when expressing recombinant atpF?

Inclusion body formation is a common challenge when expressing membrane-associated proteins like ATP synthase subunit b. Several strategies have proven effective in addressing this issue:

Table 3: Strategies to Reduce Inclusion Body Formation

StrategyImplementationMechanismEffectiveness
Reduce expression rateLower temperature (16-25°C), decreased inducer concentration (0.1-0.5 mM IPTG)Slows protein synthesis, allowing proper foldingHigh; widely used approach
Modify expression vectorUse weak promoters (tac, araC, trc), low copy number plasmidsReduces protein synthesis rateModerate to high effectiveness
Solubility-enhancing fusion partnersMBP, SUMO, Thioredoxin tagsImprove protein solubilityVariable; depends on specific protein
Chaperone co-expressionCo-express GroEL/GroES, DnaK/DnaJ/GrpEAssist in proper protein foldingModerate; depends on specific folding bottlenecks
Specialized host strainsC41(DE3), C43(DE3)Specifically adapted for membrane protein expressionHigh for membrane proteins
Express soluble domainsFocus on dimerization domain (residues 62-122)Avoids hydrophobic transmembrane regionHigh, but provides partial protein information

Research has demonstrated that high copy number expression plasmids can lead to inclusion body formation due to high rates of heterogeneous protein expression. Using a low copy number plasmid (0-50 copies/cell) is beneficial for yielding soluble proteins compared to high copy number plasmids (100+ copies/cell) .

A comprehensive approach combining multiple strategies often yields the best results. For instance, expressing the soluble dimerization domain (residues 62-122) of ATP synthase subunit b at low temperature with an MBP fusion tag in a low copy number vector has proven effective for structural studies .

What methodological approaches can help distinguish between monomeric and dimeric forms of ATP synthase subunit b?

Distinguishing between monomeric and dimeric forms of ATP synthase subunit b is essential for functional studies. Several complementary techniques can be employed:

  • Blue Native PAGE (BN-PAGE): This non-denaturing electrophoresis technique preserves protein complexes and can separate different oligomeric states.

    • Studies have shown that BN-PAGE followed by immunoblot analysis using antibodies against ATP synthase components can effectively visualize F1Fo dimer, monomer, and free F1 moiety .

    • This technique revealed that depletion of ATP synthase components leads to decreased levels of F1Fo dimer and monomer while increasing free F1 moiety .

  • Size Exclusion Chromatography (SEC):

    • Can separate proteins based on their hydrodynamic radius

    • Particularly effective when combined with multi-angle light scattering (SEC-MALS) to determine absolute molecular weight

  • Analytical Ultracentrifugation (AUC):

    • Provides information on the sedimentation coefficient and frictional ratio

    • Studies have shown that the b subunit dimer is extremely elongated, with a frictional ratio of 1.60

  • Small-Angle X-ray Scattering (SAXS):

    • Provides information on protein shape and dimensions in solution

    • Has been used to demonstrate that the b subunit dimer has a maximal dimension of 95 Å and a radius of gyration of 27 Å

  • Crosslinking Studies:

    • Chemical crosslinking followed by SDS-PAGE can capture transient interactions

    • Mass spectrometry analysis of crosslinked peptides can identify specific interaction sites

These techniques should be used in combination to provide a comprehensive characterization of ATP synthase subunit b oligomeric states and structural properties.

How can researchers effectively validate the functionality of recombinant atpF in experimental systems?

Validating the functionality of recombinant ATP synthase subunit b requires multiple complementary approaches:

Studies of ATP synthase components have demonstrated that knockdown of specific subunits can have distinct effects on complex assembly. For example, depletion of a putative b subunit homolog in T. brucei reduced levels of F1Fo dimer and monomer complexes while increasing free F1 moiety . Similar approaches could be used to validate recombinant atpF functionality.

How might recombinant atpF be utilized in developing novel detection methods for E. coli O157:H7?

Recombinant ATP synthase subunit b offers promising opportunities for developing sensitive and specific detection methods for E. coli O157:H7, a pathogen of significant public health concern:

  • Reporter phage-based detection:

    • Bacteriophage ΦV10 has been modified to express NanoLuc luciferase (Nluc) for E. coli O157:H7 detection

    • This system can detect as few as 4.68 CFU per assay in approximately 9 hours and 46.8 cells in approximately 7 hours

    • Similar approaches targeting ATP synthase could enhance specificity and sensitivity

  • Antibody-based detection systems:

    • Development of monoclonal antibodies against specific epitopes of ATP synthase subunit b

    • Integration into lateral flow assays or ELISA-based systems for rapid field testing

  • CRISPR-based detection platforms:

    • Cas systems targeting unique sequences in the atpF gene could provide highly specific detection

    • Could be coupled with reporter systems for visual detection

  • Aptamer-based biosensors:

    • Selection of DNA or RNA aptamers with high affinity for the b subunit

    • Development of electrochemical or optical biosensors for portable detection

The advantage of targeting ATP synthase components is that they are essential for bacterial metabolism, potentially allowing detection of viable cells specifically. This is particularly important given the public health significance of viable but nonculturable (VBNC) E. coli O157:H7 in foodborne outbreaks .

What research gaps exist in understanding the role of ATP synthase in E. coli O157:H7 pathogenicity?

Despite considerable research on ATP synthase structure and function, several important knowledge gaps remain regarding its role in E. coli O157:H7 pathogenicity:

  • Stress response mechanisms: How changes in ATP synthase activity contribute to survival under various stress conditions encountered during infection remains poorly understood. Studies have shown that the formation of viable but nonculturable (VBNC) E. coli O157:H7 involves complex physiological changes , but the specific role of ATP synthase in this process requires further investigation.

  • Host-pathogen interactions: Whether ATP synthase components directly interact with host factors during infection is unknown. Research on other bacterial pathogens has revealed that metabolic enzymes can have moonlighting functions in virulence.

  • Regulatory networks: The integration of ATP synthase regulation with virulence gene expression networks remains to be fully elucidated. Transcriptomic and proteomic approaches have revealed complex regulatory changes during VBNC state formation , but comprehensive models linking energy metabolism to virulence are lacking.

  • Strain-specific variations: Differences in ATP synthase structure or regulation between pathogenic and non-pathogenic E. coli strains could contribute to virulence but have not been systematically investigated.

  • Environmental adaptation: How ATP synthase function is modulated during transition between environmental reservoirs and the host environment, potentially contributing to persistence and transmission.

Addressing these knowledge gaps will require integrative approaches combining structural biology, systems biology, and infection models to fully understand the multifaceted roles of ATP synthase in E. coli O157:H7 pathogenicity.

How can recombinant atpF contribute to ATP regeneration systems for biotechnology applications?

Recombinant ATP synthase components, including subunit b, could play important roles in developing efficient ATP regeneration systems for biotechnology applications:

  • Enzyme-coupled ATP regeneration:

    • Similar to how Thermus polyphosphate kinase has been used to regenerate ATP from polyphosphate

    • A recombinant E. coli strain producing Thermus polyphosphate kinase successfully regenerated ATP by using exogenous polyphosphate

    • This system was effective for producing fructose 1,6-diphosphate from fructose and polyphosphate

  • Enhanced stability and efficiency:

    • Engineering ATP synthase components for increased thermostability

    • Optimizing subunit interactions for improved catalytic efficiency

    • Designing minimal functional units for specific applications

  • Integrated biocatalytic systems:

    • Coupling ATP synthase-based regeneration with ATP-dependent enzymatic reactions

    • Co-expression of multiple enzymes in a single recombinant organism

    • Heat-treated E. coli recombinants producing multiple thermostable enzymes can be used directly as reaction platforms

  • Industrial applications:

    • Production of high-value compounds requiring ATP-dependent steps

    • Development of continuous-flow biocatalytic systems with integrated ATP regeneration

    • Creation of self-sustaining cell-free reaction systems

The successful use of recombinant Thermus polyphosphate kinase for ATP regeneration demonstrates the potential of this approach. When combined with thermostable fructokinase and phosphofructokinase, this system successfully synthesized fructose 1,6-diphosphate at 70°C . Similar strategies could be developed using engineered ATP synthase components optimized for specific biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.