Recombinant Escherichia coli O157:H7 Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
clsA; cls; ECH74115_1735; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Target Names
clsA
Target Protein Sequence
MTTVYTLVSWLAILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLAVGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAEENSSVAAPLFKLCERRQGIAGVKGNQ LQLMTESDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAAARRGIHCRLMLD SAGSVAFFHSPWPELMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMIMIDNYIAYTGSM NMVDPRYFKQDAGVGQWIDLMARMEGPIATAMGIIYSCDWEIETGKRILPPPPDVNIMPF EQASGHTIHTIASGPGFPEDLIHQALLTAAYSAREYLIMTTPYFVPSDDLLHAICTAAQR GVDVSIILPRKNDSMLVGWASRAFFTELLAAGVKVYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLAIDDKGFGADLAAVQDDYISRSRLLDARLWLKRPLWQRVAERLFY FFSPLL
Uniprot No.

Target Background

Function

Function: Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL) (diphosphatidylglycerol) and glycerol.

Database Links
Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of cardiolipin synthase in E. coli O157:H7?

Cardiolipin synthase (CLS) in E. coli O157:H7 catalyzes the transfer of a phosphatidyl group from cytidine diphosphate-diacylglycerol (CDP-DAG) to phosphatidylglycerol (PG), forming cardiolipin (CL). This reaction is fundamental to bacterial membrane phospholipid composition and occurs at the cytoplasmic membrane. The conversion is highly efficient, resulting in minimal residual PG in bacterial membranes, as observed in studies of mitochondrial CLS with similar functionality . The enzyme in E. coli is often referred to as CLS or ClsA (cardiolipin synthase A) in the literature and is encoded by the cls gene .

How does cardiolipin contribute to E. coli O157:H7 pathogenesis and survival?

Cardiolipin plays a critical role in E. coli O157:H7 persistence and colonization in bovine hosts. Research indicates that pO157, a plasmid in E. coli O157:H7 that may influence cardiolipin metabolism, is required for optimal survival and persistence in cattle, which serve as the primary reservoir for this pathogen. Studies comparing wild-type E. coli O157:H7 with plasmid deletion derivatives demonstrate differences in survival under various environmental stresses, including acidic conditions, osmotic pressure, and temperature fluctuations . The membrane composition, including cardiolipin content, appears to contribute to the bacterium's ability to withstand gastrointestinal transit and establish colonization in the bovine rectoanal junction mucosa, which is crucial for its persistence in the environment and subsequent human infection .

What expression systems are most effective for producing recombinant E. coli O157:H7 cardiolipin synthase?

For optimal expression of recombinant E. coli O157:H7 cardiolipin synthase, a prokaryotic expression system using E. coli as the host organism has proven most effective. The gene encoding CLS (cls or clsA) can be cloned into expression vectors containing strong inducible promoters such as the tac promoter. Successful expression has been achieved using pBR322 derivatives where the cls gene is positioned downstream of the tac promoter, allowing controlled induction with isopropyl β-D-thiogalactoside (IPTG) .

To enhance expression and facilitate purification, the addition of affinity tags such as a His-tag (typically at the N-terminus) is recommended. This approach has been successfully demonstrated with recombinant full-length E. coli O157:H7 cardiolipin synthase (protein code B5YYF4), enabling expression of the complete 486-amino acid protein with minimal effect on enzymatic activity .

What are the optimal conditions for induction and expression of recombinant cardiolipin synthase?

Optimal induction conditions for recombinant cardiolipin synthase expression involve careful consideration of several parameters:

  • Inducer concentration: IPTG at concentrations between 0.5-1.0 mM has been shown to effectively induce expression when using the tac promoter system.

  • Induction temperature: Lower temperatures (16-25°C) often yield better results for membrane proteins like CLS, reducing inclusion body formation.

  • Induction duration: Extended induction periods (12-24 hours) at lower temperatures can increase yield while maintaining protein solubility and activity.

  • Growth phase: Induction at mid-log phase (OD600 ~0.6-0.8) typically provides optimal balance between cell density and expression capacity.

It's important to note that overexpression of cardiolipin synthase can significantly alter membrane composition and cellular physiology. Research has demonstrated that upon induction, cardiolipin content increases substantially, which can lead to decreased membrane potential, increased fragility of spheroplasts, and reduced cell viability. This effect may select for inducer-resistant mutants at high frequency, necessitating careful optimization of expression conditions .

What purification strategies yield the highest specific activity of recombinant cardiolipin synthase?

Purification of recombinant E. coli O157:H7 cardiolipin synthase with high specific activity can be achieved through a strategic combination of techniques:

  • Membrane isolation: Since CLS is a membrane-associated protein, initial purification steps should include isolation of the membrane fraction through differential centrifugation.

  • Detergent extraction: Gentle solubilization using non-ionic detergents such as Triton X-100 (at 0.015-2%) has been shown to effectively extract the enzyme while maintaining activity. The selection of appropriate detergent concentration is critical, as demonstrated in published protocols .

  • Affinity chromatography: For His-tagged recombinant CLS, immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar matrices provides highly selective purification.

  • Ion exchange chromatography: Phosphocellulose column chromatography has been successfully employed as an effective purification step, with properly optimized conditions yielding preparations with specific activity approximately 10,000-times higher than that of wild-type whole cell lysate .

The purified enzyme should be stored in buffer containing appropriate stabilizers, often including 6% trehalose at pH 8.0, and aliquoted for long-term storage at -20°C or -80°C to prevent activity loss from repeated freeze-thaw cycles .

What are the validated methods for measuring cardiolipin synthase activity in vitro?

Several methods have been developed to measure cardiolipin synthase activity in vitro, with the radioactive assay being the most sensitive and specific:

  • Radioactive assay: This approach measures the radioactivity of glycerol formed from phosphatidyl [2-³H]glycerol during the CLS reaction. The assay is enhanced by including 400 mM phosphate and 0.015% Triton X-100, which markedly activate the enzyme. This method provides high sensitivity and specificity for quantifying CLS activity .

  • Substrate consumption assay: Measurement of the decrease in phosphatidylglycerol concentration can be conducted using thin-layer chromatography (TLC) with appropriate lipid staining or detection methods.

  • Product formation assay: Monitoring the accumulation of cardiolipin can be performed using liquid chromatography coupled with mass spectrometry (LC-MS).

For consistent results, reaction conditions should be carefully controlled, including:

  • pH (typically alkaline, similar to human CLS optimal pH)

  • Temperature (usually 30-37°C)

  • Divalent cation concentration (typically Mg²⁺ or Mn²⁺)

  • Detergent type and concentration (critical for maintaining enzyme solubility and activity)

How does buffer composition affect the enzymatic activity of recombinant cardiolipin synthase?

Buffer composition significantly impacts the enzymatic activity of recombinant cardiolipin synthase. Key considerations include:

  • pH: E. coli CLS, like its human counterpart, likely exhibits optimal activity at alkaline pH. Human CLS shows an alkaline pH optimum, which may be similar for the bacterial enzyme .

  • Ionic strength: High phosphate concentration (400 mM) has been demonstrated to markedly enhance CLS activity in assay conditions .

  • Detergents: Low concentrations of non-ionic detergents (0.015% Triton X-100) are critical for maintaining enzyme solubility while preserving activity. The specific detergent concentration represents a delicate balance between solubilization and denaturation .

  • Divalent cations: CLS requires divalent cations for activity. Studies on human CLS indicate this requirement, and it's likely the E. coli enzyme shares this property. Mg²⁺ or Mn²⁺ at millimolar concentrations are typically employed .

  • Stabilizing agents: Addition of glycerol (5-50%) in storage buffers helps maintain enzyme stability during long-term storage, with 50% being a commonly used final concentration .

When establishing assay conditions, it's advisable to systematically evaluate these parameters to determine optimal conditions for the specific recombinant CLS preparation being studied.

What substrates does E. coli O157:H7 cardiolipin synthase preferentially utilize?

E. coli O157:H7 cardiolipin synthase utilizes two primary substrates: cytidinediphosphate-diacylglycerol (CDP-DAG) and phosphatidylglycerol (PG). While specific substrate preference data for the O157:H7 CLS is limited in the provided search results, insights can be drawn from studies of related enzymes.

The enzyme may exhibit differential preferences for specific molecular species of CDP-DAG compared to PG, similar to what has been observed with human CLS . This substrate selectivity could be important for determining the final acyl chain composition of cardiolipin in bacterial membranes.

The conversion efficiency of the reaction is notably high, as evidenced by the observation that bacterial membranes typically contain only trace amounts of PG because of its efficient conversion to cardiolipin . This suggests that the enzyme has evolved to efficiently utilize available PG, which is consistent with the critical role of cardiolipin in bacterial membrane function.

How does cardiolipin content affect the virulence and stress response of E. coli O157:H7?

Cardiolipin content significantly influences E. coli O157:H7 virulence and stress response through multiple mechanisms:

  • Membrane integrity and stress resistance: Cardiolipin alters membrane fluidity and permeability, contributing to bacterial survival under various environmental stresses. Studies investigating plasmid pO157, which affects lipid metabolism, have demonstrated its importance for survival under acidic, high-salt, and thermal stress conditions that pathogens encounter during host colonization .

  • Colonization capacity: Research shows that pO157, which influences membrane composition including cardiolipin distribution, is required for E. coli O157:H7 adherence to bovine rectoanal junction (RAJ) mucosa and for long-term colonization in cattle. This suggests that proper membrane phospholipid composition, including cardiolipin, is essential for adhesion and persistence in the bovine reservoir .

  • Gastrointestinal transit survival: E. coli O157:H7 must withstand acidic conditions in the stomach and competitive environments in the intestine. Membrane composition plays a crucial role in this survival, with cardiolipin contributing to acid resistance mechanisms .

The relationship between cardiolipin and virulence factors is complex and likely involves interactions with membrane-associated virulence systems, including secretion apparatuses and adhesins that facilitate host-pathogen interactions.

Can recombinant cardiolipin synthase be used as a target for novel antimicrobial development?

Recombinant cardiolipin synthase presents a promising target for novel antimicrobial development based on several characteristics:

  • Essential function: Cardiolipin plays critical roles in bacterial membrane structure and function, particularly under stress conditions relevant to host infection.

  • Differential features: While both prokaryotes and eukaryotes possess cardiolipin synthases, there are significant differences in structure and regulation that could be exploited for selective targeting.

  • Vulnerability point: Overexpression studies demonstrate that perturbation of cardiolipin synthesis dramatically affects bacterial viability, membrane potential, and cellular integrity, suggesting that inhibition could effectively compromise bacterial survival .

Potential approaches for targeting CLS include:

  • Small molecule inhibitors designed to interfere with the catalytic site

  • Compounds that disrupt protein-membrane interactions essential for CLS function

  • Molecules that alter substrate availability or recognition

Drug development efforts would benefit from structural studies of the recombinant enzyme and high-throughput screening platforms using the established radioactive assay or other activity measurement techniques . The successful amplification and purification methods developed for E. coli CLS provide valuable tools for such drug discovery initiatives.

How can recombinant cardiolipin synthase be utilized in developing detection methods for E. coli O157:H7?

Recombinant cardiolipin synthase can be leveraged in multiple strategies for developing sensitive and specific detection methods for E. coli O157:H7:

  • Antibody-based detection systems: Purified recombinant CLS can be used to generate highly specific antibodies that recognize the E. coli O157:H7 enzyme. These antibodies can then be incorporated into various detection platforms, including:

    • ELISA-based detection systems

    • Lateral flow immunoassays for rapid field testing

    • Immunomagnetic separation techniques coupled with detection systems

  • Bacteriophage-based detection: Similar to recent advances in phage-based detection of E. coli O157:H7, recombinant bacteriophages could be engineered to target bacteria based on surface markers and detect cellular components like CLS. Recent studies have demonstrated that recombinant bacteriophage systems can achieve detection of as little as 1 CFU/25g or mL of E. coli O157:H7 within 7.5 hours .

  • Molecular beacon approaches: Nucleic acid-based detection systems targeting the cls gene can be developed for specific identification of E. coli O157:H7. DNA-antibody chemical conjugates have shown superior performance in detecting pathogenic E. coli strains, including O157:H7 .

  • Biosensor development: Immobilized recombinant CLS or anti-CLS antibodies can be integrated into electrochemical or optical biosensor platforms for rapid detection.

The high specificity offered by these molecular approaches could help address the need for rapid and accurate detection methods for this important foodborne pathogen, contributing significantly to food safety monitoring systems.

Why might recombinant cardiolipin synthase show low activity despite successful expression?

Several factors can contribute to low activity of recombinant cardiolipin synthase despite successful expression:

  • Protein misfolding: As a membrane protein, CLS requires proper folding within a lipid environment. Expression conditions that fail to support correct membrane integration can result in misfolded, inactive enzyme.

  • Detergent effects: Suboptimal detergent selection or concentration during extraction and purification can denature the enzyme or interfere with its catalytic mechanism. While 0.015% Triton X-100 has been shown to markedly activate the enzyme in assay conditions, improper detergent handling during purification can be detrimental .

  • Loss of essential cofactors: Divalent cations (particularly Mg²⁺) are required for CLS activity. Insufficient concentration of these cofactors in assay buffers or their removal during purification can severely reduce enzymatic activity .

  • Protein aggregation: Thermal sensitivity and tendency toward aggregation has been observed with CLS. Research demonstrates that preincubation of cytosolic preparations at 37°C leads to enzyme aggregation and activity loss, which may also affect recombinant preparations .

  • Storage conditions: Repeated freeze-thaw cycles dramatically reduce activity. Protocols specifically recommend aliquoting the protein and avoiding repeated freeze-thaw cycles to maintain activity .

Diagnostic approaches to address these issues include size exclusion chromatography to assess aggregation state, systematic evaluation of buffer conditions, and comparison of different detergent extraction methods.

What strategies can address solubility issues when working with membrane-associated cardiolipin synthase?

Addressing solubility issues with membrane-associated cardiolipin synthase requires a multi-faceted approach:

  • Optimal detergent selection:

    • Screen multiple detergents including Triton X-100 (known to be compatible with CLS), n-dodecyl β-D-maltoside (DDM), and digitonin

    • Determine critical micelle concentration (CMC) for each detergent and test ranges around this value

    • Consider mixed detergent systems for enhanced solubilization while preserving activity

  • Buffer optimization:

    • Maintain alkaline pH (typically pH 7.5-8.5)

    • Include stabilizing agents such as glycerol (5-50%) and trehalose (6%) in storage buffers

    • Ensure adequate concentration of divalent cations (Mg²⁺ or Mn²⁺)

  • Expression modifications:

    • Reduce expression temperature (16-25°C) to slow protein production and facilitate proper membrane insertion

    • Consider co-expression with molecular chaperones that assist membrane protein folding

    • Explore fusion partners known to enhance membrane protein solubility

  • Alternative solubilization approaches:

    • Nanodiscs or liposome reconstitution to provide native-like membrane environment

    • Amphipol stabilization following initial detergent extraction

    • Styrene maleic acid lipid particles (SMALPs) for detergent-free extraction

  • Storage recommendations:

    • Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • Add glycerol to a final concentration of 50% for long-term storage

    • Maintain at -20°C/-80°C in small aliquots to prevent freeze-thaw damage

These strategies can be systematically evaluated and optimized for the specific recombinant CLS preparation, with activity assays serving as the critical readout for successful solubilization.

How can researchers optimize the purification protocol to maintain enzyme stability?

Optimizing purification protocols for maintaining cardiolipin synthase stability requires careful attention to several critical factors:

  • Temperature management throughout purification:

    • Perform all steps at 4°C when possible

    • Minimize exposure to room temperature or higher

    • Avoid extended incubations at elevated temperatures, as studies have shown that preincubation at 37°C leads to rapid loss of activity through protein aggregation

  • Buffer composition refinement:

    • Maintain pH between 7.5-8.0 throughout purification

    • Include stabilizing osmolytes such as glycerol (10-20%) during purification steps

    • Ensure consistent presence of divalent cations (typically 5-10 mM Mg²⁺)

    • Consider addition of reducing agents (1-5 mM DTT or β-mercaptoethanol) to prevent oxidation of cysteine residues

  • Optimized chromatography approach:

    • For His-tagged recombinant CLS, utilize IMAC with short binding times to minimize exposure to imidazole

    • Consider gradient elution protocols to separate fully active enzyme from partially denatured forms

    • Follow with size exclusion chromatography to remove aggregates and ensure homogeneity

    • Phosphocellulose column chromatography has proven effective in yielding high specific activity preparations

  • Final formulation for maximum stability:

    • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration for storage

    • Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • Aliquot in small volumes and flash-freeze in liquid nitrogen before transferring to -80°C

  • Quality control metrics:

    • Monitor specific activity throughout purification to identify steps causing activity loss

    • Perform thermal shift assays to evaluate buffer conditions that maximize thermal stability

    • Consider analytical SEC to confirm absence of aggregation after final purification

By implementing these optimization strategies, researchers can develop a robust purification protocol that maintains the stability and activity of recombinant cardiolipin synthase throughout isolation and storage.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.