Recombinant Escherichia coli O157:H7 Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Gene Structure and Evolutionary Context

The cobS gene in E. coli O157:H7 encodes a 247-amino-acid polypeptide (UniProt ID: B5YSS1) with a predicted molecular weight of ~28 kDa. It is part of the cob operon, which includes cobU (bifunctional cobinamide kinase-guanylyltransferase) and cobT (dimethylbenzimidazole phosphoribosyltransferase) .

FeatureDescription
Genetic LocationPart of the cob operon in E. coli O157:H7, homologous to Salmonella spp.
Expression SystemRecombinant expression in E. coli with N-terminal His-tag for purification
Evolutionary OriginHorizontal transfer of the cob operon into Salmonella from exogenous sources

Biochemical Function in Cobalamin Biosynthesis

CobS operates in the "nucleotide loop assembly" pathway, which synthesizes the lower ligand base of cobalamin. Key reactions include:

Stepwise Catalysis

  1. AdoCbi-P Synthesis: CobU phosphorylates adenosylcobinamide (AdoCbi) to form AdoCbi-P .

  2. α-Ribazole-5′-P Synthesis: CobT converts 5,6-dimethylbenzimidazole (DMB) and nicotinate mononucleotide (NaMN) into α-ribazole-5′-phosphate (α-ribazole-5′-P) .

  3. AdoCbl-5′-P Formation: CobS ligates AdoCbi-P and α-ribazole-5′-P to form AdoCbl-5′-P .

  4. Phosphate Removal: CobC dephosphorylates AdoCbl-5′-P to yield adenosylcobalamin (AdoCbl) .

EnzymeSubstrateProductReference
CobUAdenosylcobinamide (AdoCbi)AdoCbi-phosphate (AdoCbi-P)
CobTDMB + NaMN + GTPα-ribazole-5′-phosphate
CobSAdoCbi-P + α-ribazole-5′-PAdoCbl-5′-phosphate (AdoCbl-5′-P)
CobCAdoCbl-5′-PAdenosylcobalamin (AdoCbl)

In Vitro Synthesis

CobS activity was demonstrated in Salmonella typhimurium extracts, where:

  • Substrates: AdoCbi-P and α-ribazole-5′-P.

  • Product: AdoCbl-5′-P, confirmed via HPLC, UV-Vis spectroscopy, and mass spectrometry .

  • CobC Dependency: CobC dephosphorylates AdoCbl-5′-P to AdoCbl, enabling growth of cobalamin auxotrophs .

In Vivo Overexpression Risks

Overexpression of cobS in E. coli strains caused:

  • Membrane Potential Collapse: Dissipation of proton motive force due to ion leakage.

  • Cell Death: Mitigated by co-expressing cobC or pspA (a stress-response gene) to balance enzyme activity and membrane stability .

ConditionEffect on ViabilityMechanismReference
CobS OverexpressionSevere growth inhibitionMembrane depolarization, ion leakage
CobS + CobCPartial rescueDephosphorylation of AdoCbl-5′-P
CobS + PspAFull rescueStress response protein stabilization

Applications in Metabolic Engineering

Efforts to engineer E. coli for de novo cobalamin production highlighted cobS as a bottleneck:

  • Cobalt Chelatase Dependency: CobN, CobS, and CobT require cobalt for corrin ring assembly .

  • Optimized Strains: Co-expression of cobN, cobS, and cobT with cobalt uptake modules (e.g., cbiM, cbiN, cbiQ, cbiO) improved cobalamin yields .

StrainCobalamin YieldKey ModificationsReference
FH2165.72 µg/g DCWcobB (R. capsulatus) + cobN, cobS, cobT (S. meliloti)
FH32921.96 µg/g DCWcobN, cobS, cobT (R. capsulatus)

Recombinant Protein Availability

The recombinant His-tagged cobS from E. coli O157:H7 (Cat. No. RFL23103EF) is commercially available for biochemical studies:

PropertyDetailSource
Protein Length247 amino acids
PurificationAffinity chromatography (His-tag)
ApplicationEnzyme assays, structural studies

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specified tag type requirement, please communicate it to us and we will prioritize development with the specified tag.
Synonyms
cobS; ECH74115_2837; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Target Names
cobS
Target Protein Sequence
MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG APLAALFSVLVLVLMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGEPILASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGEL VFLLALL
Uniprot No.

Target Background

Function
Catalyzes the synthesis of adenosylcobalamin (Ado-cobalamin) by joining adenosylcobinamide-GDP and alpha-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of CobS in E. coli O157:H7?

CobS (Cobalamin synthase) is an integral membrane protein that catalyzes the penultimate step in adenosylcobalamin (vitamin B12) biosynthesis in E. coli O157:H7. Specifically, it performs the condensation of the activated corrin ring and lower ligand base to form adenosylcobamide phosphate (AdoCbl-P) . This represents a critical convergence point in the pathway where two separate biosynthetic branches merge.

CobS functions within a multienzyme complex associated with the cell membrane, working in concert with other enzymes like CbiB, CobU, CobT, and CobC to complete the "late steps" of adenosylcobalamin biosynthesis, which involve the assembly of the nucleotide loop . The membrane association of CobS appears to be physiologically significant, as its enzymatic activity increases substantially when inserted into a lipid bilayer, suggesting that the membrane environment is crucial for optimal function .

How can researchers successfully purify recombinant E. coli O157:H7 CobS protein?

Purification of recombinant E. coli O157:H7 CobS has historically been challenging due to its hydrophobic nature as an integral membrane protein. Recent breakthroughs have established improved protocols that yield up to 96% homogenous protein . The methodology involves:

  • Overexpression system: Cloning the cobS gene into an appropriate expression vector with an affinity tag (determined during the production process) .

  • Growth conditions: Cultivating the recombinant strain under optimized conditions to maximize protein expression while maintaining proper folding.

  • Membrane fraction isolation: Careful cell lysis followed by differential centrifugation to isolate membrane fractions containing the CobS protein.

  • Detergent solubilization: Using appropriate detergents to solubilize the membrane-bound CobS while preserving its native conformation.

  • Affinity chromatography: Purification using affinity resins specific to the tag incorporated into the recombinant protein.

  • Storage conditions: Maintaining the purified protein in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended preservation .

The protein should be handled carefully to avoid repeated freeze-thaw cycles, which can compromise its stability and activity .

What expression systems are most effective for producing recombinant CobS?

The expression of recombinant CobS presents significant challenges due to its nature as a polytopic inner membrane protein. Based on research findings, effective expression systems include:

  • E. coli-based expression systems: These are most commonly used for CobS expression, utilizing strains optimized for membrane protein production such as C41(DE3) or C43(DE3).

  • Vector selection: Vectors containing regulatable promoters (like T7 or tac) allow for controlled expression, which is crucial since overexpression of membrane proteins can be toxic to host cells.

  • Fusion partners: The incorporation of fusion partners such as thioredoxin or MBP (maltose-binding protein) can enhance solubility and proper folding.

  • Induction conditions: Lower temperatures (16-25°C) and reduced inducer concentrations often yield better results for membrane protein expression by slowing the production rate and allowing proper insertion into membranes.

  • Media optimization: Specialized media formulations with osmotic stabilizers or specific carbon sources can significantly improve yields.

The selection of an appropriate tag (His-tag, FLAG-tag, etc.) is determined during the production process based on the specific requirements of downstream applications .

How does membrane association affect CobS enzyme activity and what are the implications for in vitro studies?

Membrane association is critical for CobS function, with research demonstrating significantly increased enzymatic activity when the protein is inserted into a lipid bilayer compared to its solubilized form . This phenomenon has several implications for in vitro studies:

  • Reconstitution methods: Researchers have developed protocols for reconstituting purified CobS into liposomes to investigate the effect of the lipid bilayer on its function. This approach allows for controlled assessment of how membrane composition affects enzyme activity.

  • Lipid requirements: The specific lipid composition can substantially impact CobS activity. Studies suggest that phosphatidylethanolamine and cardiolipin may be particularly important for optimal function.

  • Orientation considerations: The orientation of CobS in the membrane is crucial for substrate accessibility. In reconstitution experiments, techniques such as freeze-fracture electron microscopy can be employed to verify proper insertion and orientation.

  • Assay design: When assessing CobS activity in vitro, researchers must account for the membrane environment. Detergent-solubilized assays may underestimate true enzymatic capacity, while liposome-reconstituted systems provide more physiologically relevant measurements.

A comparative analysis of CobS activity in different environments revealed:

Experimental ConditionRelative Activity (%)Substrate Binding Efficiency
Detergent-solubilized15-25Reduced
Liposome-reconstituted85-100Near native
Native membrane100 (reference)Optimal

These findings underscore the importance of membrane context when studying CobS function in vitro .

What structural motifs and key residues are essential for CobS function in E. coli O157:H7?

In vivo CobS variant analyses have identified several critical residues and motifs required for cobalamin synthase function . These include:

  • Transmembrane domains: Analysis of the amino acid sequence reveals multiple transmembrane helices essential for proper membrane insertion and formation of the catalytic pocket. The full-length protein consists of 247 amino acids forming these structural elements .

  • Conserved motifs: Several conserved sequences have been identified as crucial for substrate binding and catalysis:

    • The sequence "GLDFEHY" appears to be involved in substrate recognition

    • A "GLAPLA" motif contributes to the stability of the protein within the membrane

    • The "GLAALFSV" sequence may form part of the substrate-binding pocket

  • Catalytic residues: Site-directed mutagenesis studies have identified specific amino acids essential for the condensation reaction:

    • Conserved histidine residues likely participate in proton transfer during catalysis

    • Arginine and acidic residues (glutamate/aspartate) form charge interactions that stabilize the transition state

The protein sequence (MSKLFWAmLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCGAPLAALFSVLVLVLMTGGFHLDGLADTCDGVFSARSRDRmLEIMRDSRLGTHGGLALIFVVLAKILVLSELALRGEPILASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQTCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGELVFLLALL) contains these critical elements arranged in a specific three-dimensional configuration that facilitates its enzymatic function .

How does E. coli O157:H7 CobS differ from CobS in non-pathogenic E. coli strains?

Comparative genomic and proteomic analyses have revealed notable differences between CobS in pathogenic E. coli O157:H7 and non-pathogenic strains:

  • Sequence variation: While the core catalytic domains remain conserved, specific sequence variations occur in regions that may affect substrate specificity or regulatory interactions. The O157:H7 CobS contains subtle amino acid substitutions that potentially enhance its catalytic efficiency.

  • Genomic context: In E. coli O157:H7, the cobS gene exists within a genomic context that reflects the strain's evolutionary history. The O157:H7 strain emerged relatively recently (approximately 400 years ago) from its O55:H7 ancestor, as revealed by mutational synonymous SNP analysis . This recent divergence suggests that any differences in CobS may be relatively minor but potentially significant for adaptation.

  • Regulatory elements: The expression control mechanisms for cobS differ between pathogenic and non-pathogenic strains, potentially affecting the timing and level of expression during infection.

  • Protein-protein interactions: CobS in O157:H7 may have evolved specific interactions with other pathogenicity-associated proteins that are absent in non-pathogenic strains.

  • Post-translational modifications: Different patterns of post-translational modifications may exist between the pathogenic and non-pathogenic variants, affecting enzyme activity or stability.

What methods can be used to assess substrate binding and catalytic activity of recombinant CobS?

Investigating the substrate binding and catalytic activity of recombinant CobS requires specialized approaches due to its membrane-associated nature. Recommended methodologies include:

  • In vitro substrate binding analysis: Using purified CobS reconstituted into liposomes, researchers can measure binding of radiolabeled or fluorescently tagged substrates. Surface plasmon resonance (SPR) and isothermal titration calorimetry (ITC) can provide quantitative binding parameters .

  • Enzymatic assays: Activity can be assessed by monitoring the conversion of precursors to adenosylcobamide phosphate. Detection methods include:

    • HPLC separation and quantification of reaction products

    • Coupled enzymatic assays that link CobS activity to a detectable signal

    • Mass spectrometry to identify reaction intermediates and products

  • In vivo complementation: Functional activity can be evaluated by complementation studies in cobS-deficient strains, assessing growth under conditions requiring cobalamin.

  • Site-directed mutagenesis: Systematic mutation of predicted catalytic residues followed by activity assessment helps identify key functional regions.

  • Structural studies: Though challenging with membrane proteins, techniques such as cryo-electron microscopy or X-ray crystallography can provide insights into substrate binding pockets and catalytic mechanisms.

These approaches have revealed that CobS activity is significantly enhanced when the enzyme is inserted into a lipid bilayer, emphasizing the importance of membrane context for proper function .

How can researchers develop detection systems for E. coli O157:H7 utilizing knowledge of CobS?

Development of detection systems for E. coli O157:H7 can leverage knowledge of CobS through several innovative approaches:

  • Antibody-based detection: Researchers can generate highly specific antibodies against unique epitopes of E. coli O157:H7 CobS for use in ELISA or immunofluorescence assays. This approach relies on identifying regions of CobS that differ from homologs in non-pathogenic strains.

  • Bacteriophage-based methods: Similar to the approach used with T-even-type PP01 bacteriophage, which specifically targets E. coli O157:H7, researchers can develop phage-based detection systems that incorporate reporter proteins . While not directly targeting CobS, this approach provides a framework for developing highly specific detection methods.

  • Genetic probes: Designing nucleic acid probes targeting unique regions of the cobS gene in E. coli O157:H7 can enable PCR-based or hybridization-based detection methods.

  • Metabolic indicators: Since CobS functions in the cobalamin biosynthesis pathway, metabolic profiles specific to E. coli O157:H7 could serve as indicators of the pathogen's presence.

  • Aptamer-based detection: Developing aptamers that specifically bind to E. coli O157:H7 CobS could enable rapid detection in complex samples.

The specificity of these methods is crucial, as they must differentiate pathogenic E. coli O157:H7 from non-pathogenic E. coli strains that are part of the normal gut microbiota. The detection of viable but non-culturable (VBNC) states of the bacterium presents an additional challenge that advanced molecular methods can help address .

How does CobS function within the broader context of vitamin B12 biosynthesis in E. coli O157:H7?

CobS functions as a critical component in a complex network of enzymes involved in vitamin B12 biosynthesis:

  • Pathway integration: The "late steps" of adenosylcobalamin biosynthesis involve multiple enzymes working in concert. CobS catalyzes the penultimate step, where it condenses the activated corrin ring and lower ligand base to form adenosylcobamide phosphate .

  • Multienzyme complex: Research suggests that CobS operates within a membrane-associated multienzyme complex that includes CbiB, CobU, CobT, and CobC. This complex facilitates efficient substrate channeling and coordinated catalysis .

  • Regulatory coordination: The expression and activity of CobS are coordinated with other enzymes in the pathway to ensure balanced production of adenosylcobalamin. This coordination involves transcriptional, translational, and post-translational regulatory mechanisms.

  • Evolutionary conservation: The membrane association of CobS is conserved among all cobamide producers, suggesting a fundamental physiological significance to this localization that extends beyond E. coli O157:H7 .

  • Final processing: After CobS-catalyzed condensation, the AdoCbl-P product is dephosphorylated by the CobC enzyme (EC 3.1.3.73) to yield the final adenosylcobalamin molecule .

This integrated perspective highlights the importance of considering CobS not in isolation but as part of a sophisticated biosynthetic machinery that has evolved to efficiently produce essential cofactors.

What are the challenges in expressing and studying recombinant membrane proteins like CobS?

Working with recombinant membrane proteins like CobS presents several unique challenges that researchers must overcome:

  • Expression limitations: Overexpression often leads to toxicity, improper folding, or formation of inclusion bodies. This necessitates careful optimization of expression conditions, including temperature, inducer concentration, and host strain selection.

  • Purification difficulties: Traditional purification methods designed for soluble proteins often yield poor results with membrane proteins. Specialized detergents and chromatographic techniques are required to extract and purify CobS while maintaining its native structure.

  • Structural instability: Once removed from the membrane environment, CobS and other membrane proteins tend to aggregate or denature, compromising functional studies. Stabilizing agents or reconstitution into artificial membrane systems (liposomes) are often necessary.

  • Functional assessment complexities: Assaying the activity of membrane-bound enzymes requires considering the lipid environment's influence on function. Detergent-solubilized assays may underestimate true enzymatic capacity .

  • Reconstitution challenges: Achieving proper orientation and distribution when reconstituting CobS into liposomes requires careful optimization of lipid composition, protein-to-lipid ratios, and reconstitution methods.

Researchers have developed specialized approaches to address these challenges, including using fusion partners to enhance solubility, screening multiple detergents for optimal extraction, and developing liposome reconstitution protocols specifically tailored to maintain CobS function .

How might inhibitors of CobS be developed as potential antimicrobial agents against E. coli O157:H7?

The development of CobS inhibitors as potential antimicrobial agents represents an intriguing research direction with several considerations:

  • Target validation: Establishing CobS as an essential enzyme for E. coli O157:H7 survival or virulence is crucial. Knockout studies and growth experiments under various conditions can help validate CobS as a viable antimicrobial target.

  • Structural insights: While complete structural data may be limited due to the challenges of membrane protein crystallography, homology modeling and targeted mutagenesis studies can identify potential binding pockets for inhibitor design.

  • High-throughput screening approaches:

    • Virtual screening against predicted binding sites

    • Fragment-based drug discovery focusing on the enzyme's active site

    • Natural product libraries screening for inhibitory compounds

  • Rational design strategies: Based on substrate analogs that compete for binding or transition state mimics that interfere with catalysis.

  • Selectivity considerations: Ideal inhibitors would specifically target pathogenic E. coli O157:H7 CobS while sparing beneficial gut microbiota. This requires exploiting subtle structural differences between CobS variants in different bacterial species.

  • Delivery challenges: As CobS is a membrane-bound enzyme, inhibitors must be designed to penetrate the bacterial outer membrane and access the inner membrane where CobS resides.

Potential inhibitor types include small molecule competitive inhibitors, peptidomimetics targeting protein-protein interactions within the multienzyme complex, and allosteric modulators that disrupt conformational changes necessary for catalysis.

What genomic techniques can be used to study the evolution of CobS in pathogenic E. coli strains?

The evolution of CobS in pathogenic E. coli strains can be investigated using several advanced genomic approaches:

  • Comparative genomics: Analysis of cobS gene sequences across diverse E. coli strains reveals evolutionary patterns. Studies have shown that E. coli O157:H7 diverged from its O55:H7 ancestor relatively recently, approximately 400 years ago according to mutational synonymous SNP analysis, rather than the 14,000-70,000 years estimated by traditional clock rates .

  • Phylogenetic analysis: Construction of phylogenetic trees based on cobS sequences can elucidate the evolutionary relationships between pathogenic and non-pathogenic strains, revealing potential adaptation patterns.

  • Selective pressure analysis: Calculating the ratio of non-synonymous to synonymous substitutions (dN/dS) can identify regions of the cobS gene under positive selection, potentially highlighting functionally important adaptations in pathogenic strains.

  • Recombination detection: Methods like the four-gamete test or maximum likelihood approaches can detect historical recombination events affecting cobS. Research suggests E. coli has a lower frequency of recombination relative to mutation compared to other bacteria like Vibrio cholerae .

  • Whole genome sequencing: Analysis of broader genomic context reveals how cobS evolution relates to other genetic changes. For instance, studies have identified major differences between O55:H7 and O157:H7 strains, including different phage elements and secretion systems .

These approaches can provide insights into how CobS function may have adapted during the evolution of pathogenic E. coli strains, potentially contributing to their virulence or host adaptation.

What role might CobS play in E. coli O157:H7 pathogenesis and host interaction?

While direct evidence linking CobS to E. coli O157:H7 pathogenesis is limited, several hypotheses warrant investigation:

  • Nutrient acquisition during infection: Vitamin B12 is essential for several metabolic processes. Efficient B12 biosynthesis via CobS may provide a competitive advantage to E. coli O157:H7 during colonization of the intestinal tract, particularly in microenvironments where external B12 is limited.

  • Stress response: Vitamin B12-dependent enzymes participate in stress response pathways. Enhanced CobS function might contribute to the pathogen's ability to withstand host defense mechanisms.

  • Metabolic adaptation: The transition from environmental reservoirs (such as cattle intestines) to human hosts requires metabolic flexibility. CobS-dependent B12 biosynthesis may support this adaptation.

  • Potential coordination with virulence factors: E. coli O157:H7 produces a powerful toxin that can cause severe illness . Research could investigate whether B12-dependent processes interact with toxin production or other virulence mechanisms.

  • Host immune interaction: Some metabolites produced by bacterial vitamin B12-dependent pathways may modulate host immune responses, potentially contributing to pathogenesis.

E. coli O157:H7 is particularly associated with food contamination, especially undercooked meat products and produce items . Understanding how CobS function relates to survival in these environments could provide insights into transmission dynamics and inform prevention strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.