Recombinant Escherichia coli O157:H7 Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant RnfE is a full-length, His-tagged protein (amino acids 1–231; UniProt ID: B5Z466) expressed in E. coli . It belongs to the Rnf family of membrane-bound electron transport proteins, which facilitate energy transduction by coupling redox reactions to ion gradients .

Key Production Steps:

  • Gene Cloning: The rnfE gene is inserted into a plasmid vector under a promoter for controlled expression .

  • Host Expression: The recombinant plasmid is introduced into E. coli for protein synthesis .

  • Purification: The His-tagged protein is isolated using affinity chromatography .

Topological Comparison of RnfA and RnfE Families:

FeatureRnfA HomologuesRnfE Homologues
TopologyN<sub>out</sub>-C<sub>out</sub>N<sub>in</sub>-C<sub>in</sub>
Conserved RegionsTM1–TM5 (46% identity)TM1–TM5 (46% identity)
Key ResiduesLys/Arg-rich periplasmic loopsLys/Arg-rich cytoplasmic loops

Functional Role

RnfE participates in electron transport pathways, likely forming a complex with RnfA to mediate energy transduction between cytoplasmic enzymes (e.g., nitrogenase) and membrane-bound respiratory chains .

Proposed Mechanisms:

  • Electron Transfer: Links ferredoxin oxidation to proton/sodium ion gradients .

  • Pathogenicity: Indirectly supports virulence by enhancing metabolic flexibility in hostile environments (e.g., low pH) .

4.1. Mechanistic Studies

  • Membrane Protein Dynamics: Used to investigate topology determinants and residue-level interactions .

  • Allosteric Pathways: Serves as a model for studying long-range communication in membrane complexes .

4.2. Biotechnological Uses

  • Vaccine Development: Explored as a potential antigen for E. coli O157:H7 vaccines .

  • Diagnostic Tools: Incorporated into assays for detecting Shiga toxin-producing E. coli (STEC) .

Regulatory and Expression Insights

  • Transcriptional Control: Expression is influenced by host-pathogen interactions and environmental stressors (e.g., norepinephrine) .

  • Co-regulation: Shares regulatory networks with virulence factors like the locus of enterocyte effacement (LEE) .

Evolutionary Significance

The RnfA/RnfE pair exemplifies divergent topological evolution, where gene duplication led to inverted membrane orientations while retaining structural homology . This quasi-symmetrical arrangement may optimize electron transport efficiency .

Challenges and Future Directions

  • Functional Redundancy: Overlapping roles with RnfA complicate mechanistic dissection .

  • Therapeutic Targeting: Requires deeper understanding of its role in pathogenicity .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery times may vary based on the purchase method and location. For precise delivery information, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us beforehand, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
rsxE; rnfE; ECH74115_2344; Ion-translocating oxidoreductase complex subunit E; Rsx electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Target Names
rsxE
Target Protein Sequence
MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAGKYLIDERMKKRRTEAAAERALPNGETGNV
Uniprot No.

Target Background

Function
RnfE is a component of a membrane-bound complex that couples electron transfer with the translocation of ions across the membrane. It plays a crucial role in maintaining the reduced state of SoxR.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Rnf complex and what role does RnfE play in it?

The Rnf complex is a membrane-bound, redox-driven ion transporter present in many prokaryotes, including E. coli O157:H7. It consists of six subunits (RnfA, RnfB, RnfC, RnfD, RnfG, and RnfE) that collectively function as an electron transport chain complex . The RnfE protein is one of two membrane-integral subunits (along with RnfD) that is suggested to directly mediate ion transport across the cytoplasmic membrane .

The complex catalyzes the exergonic electron transfer from reduced ferredoxin (E₀′ = −500 to −450 mV) to NAD⁺ (E₀′ = −320 mV), coupling this reaction to the electrogenic translocation of ions (either Na⁺ or H⁺, depending on the organism) . This function allows the Rnf complex to energetically link cellular pools of ferredoxin and NAD⁺, serving as an energy-coupled transhydrogenase .

How is the Rnf complex structured, and what are the specific characteristics of RnfE?

The Rnf complex has a distinct multi-subunit organization with specific roles for each component. The structure and characteristics of the subunits are summarized in the following table, with particular emphasis on RnfE:

SubunitSize (bp)Mass (kDa)Predicted localizationTMH (Transmembrane Helices)Experimental localizationCofactors predictedCofactors experimentally found
RnfA58821.4Membrane integral6Membrane
RnfB1,00236.6Membrane associated1–2MembraneFeSFeS
RnfC1,33248.7Soluble0MembraneFeSFeS
RnfD96035Membrane integral6–9MembraneFMNFMN
RnfE59121.6Membrane integral6Membrane
RnfG62422.8Membrane associated1MembraneFMNFMN

As shown in the table, RnfE is a 591 bp protein with a mass of 21.6 kDa. It contains approximately 6 transmembrane helices and is experimentally confirmed to be membrane-localized. Unlike some other Rnf subunits, RnfE does not appear to contain cofactors .

What are the established methods for isolating and purifying recombinant RnfE protein from E. coli O157:H7?

Isolating and purifying recombinant RnfE protein presents significant challenges due to its hydrophobic nature as a membrane-integral protein. Researchers have successfully purified the complete Rnf complex from Thermotoga maritima , which provides a methodological framework that can be adapted for E. coli O157:H7.

The recommended approach involves:

  • Molecular cloning of the rnfE gene into an appropriate expression vector with a suitable affinity tag (His-tag is commonly used)

  • Expression in an E. coli strain optimized for membrane protein production

  • Cell disruption typically via French press or sonication

  • Membrane isolation through differential centrifugation

  • Solubilization of membrane proteins using appropriate detergents (typically n-dodecyl β-D-maltoside or Triton X-100)

  • Affinity chromatography purification using the engineered tag

  • Size exclusion chromatography for further purification

The critical consideration is maintaining the native conformation of the protein during purification, as membrane proteins often denature easily when removed from their lipid environment .

How can I design experiments to measure the ion transport activity of recombinant RnfE in E. coli O157:H7?

Measuring ion transport activity requires careful experimental design to distinguish RnfE-specific activity from background transport. A methodological approach involves:

  • Preparation of inverted membrane vesicles: Isolate membranes from E. coli O157:H7 expressing recombinant RnfE and control strains. Create inverted membrane vesicles through mechanical disruption and resealing.

  • Ion transport assays: For Na⁺ transport studies, use radioactive ²²Na⁺ or fluorescent Na⁺ indicators (e.g., SBFI). For H⁺ transport, employ pH-sensitive fluorophores (e.g., ACMA or pyranine).

  • Initiation of electron transport: Add reduced ferredoxin and NAD⁺ to initiate electron transport through the Rnf complex.

  • Measuring ion accumulation: Monitor ion accumulation inside the vesicles over time. For radioactive assays, filter vesicles and measure radioactivity; for fluorescent assays, record changes in fluorescence.

  • Control experiments: Include ionophores (e.g., monensin for Na⁺, CCCP for H⁺) to confirm the specificity of transport. Also, use specific inhibitors or RnfE knockout controls to verify the role of RnfE .

The key to successful measurement is ensuring that the recombinant RnfE is correctly integrated into the membrane and maintaining physiological conditions during the assay.

How does the RnfE protein from E. coli O157:H7 differ from its homologs in other bacteria, and what are the functional implications?

E. coli O157:H7 RnfE exhibits structural and functional differences compared to homologs in other bacteria, which has important implications for energy metabolism and pathogenicity:

  • Structural comparisons: Comparative genomic analysis shows that while the basic structure of RnfE is conserved across bacterial species, there are variations in transmembrane topology and specific residues involved in ion coordination. For instance, the RnfE protein in E. coli O157:H7 shares homology with the NqrD subunit of the Na⁺-NQR complex but has evolved distinct functional features .

  • Ion specificity: The Rnf complex in some bacteria (like Acetobacterium woodii) is Na⁺-specific, while in others, it may transport H⁺. The specific ion transported by E. coli O157:H7 RnfE appears to depend on critical residues in the transmembrane domains .

  • Evolutionary adaptations: The Rnf complex in E. coli O157:H7 has evolved more rapidly than in its O55:H7 ancestor. Genomic analysis revealed that the O157:H7 lineage has accumulated 50% more synonymous mutations compared to O55:H7, suggesting potential functional adaptations in the Rnf complex that may contribute to its enhanced pathogenicity .

  • Pathogenicity correlation: The differences in RnfE and the Rnf complex might contribute to the enhanced virulence of E. coli O157:H7 compared to non-pathogenic strains, possibly by providing more efficient energy metabolism under the anaerobic conditions of the human intestine .

These differences suggest that E. coli O157:H7 RnfE has evolved specific adaptations that may contribute to the organism's pathogenicity and environmental persistence.

What is the current understanding of how RnfE contributes to E. coli O157:H7 virulence and pathogenicity?

The contribution of RnfE to E. coli O157:H7 virulence represents an emerging area of research:

  • Energy metabolism in host environments: The Rnf complex, including RnfE, provides a critical mechanism for energy conservation during growth in the anaerobic environment of the intestine. By coupling ferredoxin oxidation to NAD⁺ reduction with ion transport, it generates a membrane potential that can drive ATP synthesis, potentially supporting rapid growth during infection .

  • Adaptation to stress conditions: The ability of the Rnf complex to work bidirectionally allows E. coli O157:H7 to adapt to changing redox conditions in the host. When NADH levels are high relative to reduced ferredoxin, the complex can work in reverse to generate reduced ferredoxin needed for biosynthetic reactions and stress responses .

  • Metabolic flexibility: The Rnf complex contributes to metabolic versatility by allowing E. coli O157:H7 to utilize diverse carbon sources in the intestinal environment, potentially providing a competitive advantage over commensal bacteria and contributing to successful colonization .

  • Virulence factor expression: While not directly proven, there is evidence suggesting that the energy metabolism supported by the Rnf complex may influence the expression of virulence factors like Shiga toxins, which are responsible for the severe clinical manifestations of E. coli O157:H7 infection .

Research using deletion mutants in related bacterial systems has shown that disruption of the Rnf complex can significantly reduce virulence, suggesting that RnfE and other Rnf components may be potential targets for novel therapeutic approaches against E. coli O157:H7 infections .

What are the most sensitive and specific methods for detecting recombinant E. coli O157:H7 expressing RnfE in experimental samples?

Several advanced methods can be employed for detecting recombinant E. coli O157:H7 expressing RnfE, each with specific advantages:

  • Real-time PCR targeting rnfE gene: This approach can detect as few as 6.4 × 10³ CFU/ml (equivalent to 7.9 × 10⁻⁵ g/ml of genomic DNA) of E. coli O157:H7 . The methodology involves:

    • DNA extraction from samples

    • Amplification using rnfE-specific primers

    • Detection using fluorescent probes

    • Quantification based on standard curves of CT values versus colony counts

  • Recombinant bacteriophage-based detection: By using bacteriophages specific to E. coli O157:H7 (such as PP01) that can be engineered to express reporter proteins like GFP, researchers can achieve detection limits as low as 1 CFU/25g of sample within 7.5 hours .

  • Sandwich ELISA using anti-RnfE antibodies: ELISA-based methods offer high specificity by using antibodies targeting the RnfE protein. Commercial kits based on this principle can detect E. coli O157:H7 in various food and environmental samples with sensitivity ranges of 6.25×10³ to 4×10⁵ CFU/ml .

  • Combined enrichment-PCR approach: For samples with very low bacterial loads, a single enrichment step followed by PCR can detect <10 CFU of E. coli O157:H7, significantly enhancing sensitivity .

The choice of method depends on the specific research context, required sensitivity, and available equipment. For the highest sensitivity in complex matrices, a combination of enrichment culture followed by molecular detection is recommended.

How can I design experimental tables to organize and analyze data related to RnfE function in E. coli O157:H7?

Designing effective experimental data tables for RnfE function research requires careful consideration of structure, variables, and FAIR data principles (Findable, Accessible, Interoperable, Reusable) :

  • Basic structure for RnfE expression experiments:

Sample IDStrain DescriptionGrowth ConditionsrnfE Expression Level (qPCR)RnfE Protein Level (Western Blot)Membrane Potential (mV)ATP Production (μmol/mg protein)
O157-WT-AE1O157:H7 Wild TypeAerobic, LB, 37°C1.00 (reference)1.00 (reference)−120 ± 54.2 ± 0.3
O157-WT-AN1O157:H7 Wild TypeAnaerobic, LB, 37°C3.24 ± 0.212.87 ± 0.18−135 ± 76.8 ± 0.4
O157-ΔrnfE-AE1O157:H7 ΔrnfEAerobic, LB, 37°C0.000.00−90 ± 82.3 ± 0.2
O157-ΔrnfE-AN1O157:H7 ΔrnfEAnaerobic, LB, 37°C0.000.00−75 ± 101.9 ± 0.3
O157-rnfE+-AE1O157:H7 ΔrnfE+prnfEAerobic, LB, 37°C4.56 ± 0.323.98 ± 0.25−125 ± 64.5 ± 0.4
O157-rnfE+-AN1O157:H7 ΔrnfE+prnfEAnaerobic, LB, 37°C12.34 ± 0.879.76 ± 0.62−145 ± 97.2 ± 0.5
  • For ion transport activity measurements:

Sample IDProtein PreparationSubstrate CombinationInitial Rate of Na⁺ Transport (nmol/min/mg)Na⁺ Accumulation after 10 min (nmol/mg)Effect of Ionophores (%)
WT-IMV-1Wild type inverted membrane vesiclesFd(red) + NAD⁺34.5 ± 2.1275 ± 18−95 (monensin)
ΔrnfE-IMV-1ΔrnfE inverted membrane vesiclesFd(red) + NAD⁺5.2 ± 0.442 ± 5−30 (monensin)
RnfE+-IMV-1Complemented ΔrnfE inverted membrane vesiclesFd(red) + NAD⁺38.7 ± 2.5310 ± 22−92 (monensin)
WT-IMV-2Wild type inverted membrane vesiclesNADH + Fd(ox)−12.3 ± 1.1−98 ± 8−90 (monensin)
ΔrnfE-IMV-2ΔrnfE inverted membrane vesiclesNADH + Fd(ox)−2.1 ± 0.3−18 ± 3−25 (monensin)
RnfE+-IMV-2Complemented ΔrnfE inverted membrane vesiclesNADH + Fd(ox)−14.5 ± 1.3−112 ± 11−88 (monensin)
  • For RnfE site-directed mutagenesis experiments:

MutationPosition (TMH)Conservation ScoreNa⁺ Transport Activity (% of WT)H⁺ Transport Activity (% of WT)ATP Production (% of WT)Growth Rate (% of WT)
Wild typeN/AN/A100100100100
D45ATMH20.9223 ± 395 ± 545 ± 468 ± 3
E78QTMH30.8818 ± 290 ± 642 ± 365 ± 4
K126RTMH40.7685 ± 787 ± 490 ± 595 ± 2
R152KCytoplasmic loop0.6592 ± 690 ± 593 ± 497 ± 3
H183ATMH50.8130 ± 482 ± 752 ± 571 ± 4

When designing these tables, follow these principles:

  • Include all relevant metadata (strains, conditions, preparation methods)

  • Report values with appropriate statistical measures (mean ± standard deviation)

  • Use consistent units throughout

  • Provide clear sample identifiers that encode key experimental variables

  • Include appropriate controls for each experimental variable

These structured tables facilitate data analysis, improve reproducibility, and adhere to FAIR data principles for scientific research.

How should I design differential expression experiments to study RnfE regulation in E. coli O157:H7 under different conditions?

Designing differential expression experiments for RnfE requires careful consideration of experimental factors and statistical analysis approaches:

  • Experimental design structure:

    • Use a balanced factorial design with multiple factors (e.g., oxygen availability, pH, temperature)

    • Include at least 3-4 biological replicates per condition for statistical power

    • Consider time-course experiments to capture dynamic regulation

  • Factor table example for RnfE expression study:

FactorLevel 1Level 2Level 3
Oxygen conditionAerobicMicroaerobicAnaerobic
pH5.57.08.5
Growth phaseEarly logMid logStationary
Carbon sourceGlucoseGlycerolLactate
  • Analysis workflow:

    • Quality control of expression data

    • Normalization appropriate to the methodology used

    • Differential expression analysis using tools like DESeq2

    • Multiple testing correction (e.g., Benjamini-Hochberg method)

    • Post-hoc testing to determine specific differences between conditions

  • Data interpretation recommendations:

    • Compare RnfE expression to other Rnf complex genes to detect coordinated regulation

    • Correlate expression with phenotypic measurements (growth rate, membrane potential)

    • Validate key findings with alternative methods (e.g., Western blot)

    • Consider regulon analysis to identify potential transcription factors controlling RnfE expression

This approach ensures robust statistical analysis and meaningful biological interpretation of RnfE regulation under different environmental conditions .

What are the current challenges and knowledge gaps in understanding the role of RnfE in E. coli O157:H7 pathogenesis?

Despite significant advances, several important challenges and knowledge gaps remain in understanding RnfE's role in E. coli O157:H7 pathogenesis:

  • Structural characterization: The precise molecular structure of RnfE remains unresolved. While predictions suggest 6 transmembrane helices, the atomic-level structure that would reveal ion coordination sites and interaction interfaces is unknown. This limits rational design of inhibitors targeting RnfE .

  • Ion selectivity mechanism: Although the Rnf complex is known to transport ions, the molecular determinants that specify whether Na⁺ or H⁺ is transported remain poorly understood. For E. coli O157:H7 specifically, it's unclear which ion is preferentially transported under different physiological conditions .

  • Regulation in vivo: The regulatory networks controlling rnfE expression during infection remain largely uncharacterized. How host environmental cues modulate RnfE function during different stages of infection is a significant knowledge gap .

  • Contribution to virulence: While the Rnf complex is important for energy metabolism, the direct contribution of RnfE to virulence factor expression, colonization, and pathogenesis needs further investigation through in vivo infection models .

  • Therapeutic targeting potential: The feasibility of targeting RnfE pharmacologically to attenuate E. coli O157:H7 virulence remains unexplored. Questions about essential residues, potential inhibitor binding sites, and the consequences of inhibition on pathogenesis need to be addressed .

  • Interaction with host factors: How RnfE and the Rnf complex activity might be influenced by host factors during infection (e.g., immune response, intestinal physiology) represents a significant knowledge gap.

Addressing these challenges will require interdisciplinary approaches combining structural biology, biochemistry, microbial genetics, and infection biology to fully elucidate the role of RnfE in E. coli O157:H7 pathogenesis and identify potential therapeutic interventions .

How has the RnfE protein evolved in E. coli O157:H7 compared to its ancestral strain O55:H7, and what are the functional implications?

The evolution of RnfE in E. coli O157:H7 from its ancestral O55:H7 strain provides important insights into pathogen adaptation:

  • Evolutionary timeline: Genomic analysis using synonymous mutation rates suggests that E. coli O157:H7 diverged from O55:H7 approximately 400 years ago (using new molecular clock rates), much more recently than previously estimated (14,000-70,000 years) . During this relatively short evolutionary period, significant changes occurred in electron transport complexes including the Rnf system.

  • Mutational patterns: E. coli O157:H7 accumulated approximately 50% more synonymous mutations compared to O55:H7, indicating accelerated evolution of proteins including RnfE. This suggests selective pressure possibly related to adaptation to new ecological niches, including human hosts .

  • Functional adaptations: Comparative proteomic analysis between O157:H7 and O55:H7 reveals divergence at the protein level, potentially affecting RnfE function. These changes may contribute to altered electron transport efficiency, providing O157:H7 with metabolic advantages during colonization and infection .

  • Lateral gene transfer influence: The evolution of the Rnf complex in O157:H7 has been influenced by lateral gene transfer events and phage acquisition. While O55:H7 contains 19 phage genomes or phage-like elements, O157:H7 contains 23, with only three common to both strains . This genomic plasticity may have contributed to changes in the regulation and function of energy metabolism genes including rnfE.

  • Implications for pathogenicity: The evolutionary changes in RnfE and other energy metabolism proteins correlate with the enhanced virulence of O157:H7 compared to O55:H7. The adaptive evolution of these systems may contribute to more efficient energy generation during infection, supporting the production of virulence factors like Shiga toxins .

These evolutionary insights suggest that changes in energy metabolism proteins like RnfE may represent key adaptive events in the emergence of highly pathogenic E. coli O157:H7 from its less virulent ancestor.

What are the most promising new approaches for studying RnfE function and developing targeted interventions against E. coli O157:H7?

Several innovative approaches show promise for advancing our understanding of RnfE function and developing targeted interventions:

  • Cryo-electron microscopy for structure determination: Applying cryo-EM techniques to the Rnf complex could reveal the precise structure of RnfE and its integration within the complex, providing insights for rational drug design. Recent advances in membrane protein cryo-EM make this increasingly feasible .

  • CRISPR-based genome editing: Precise genetic manipulation using CRISPR-Cas9 systems allows for:

    • Introduction of point mutations to study specific RnfE residues

    • Creation of conditional knockdowns to study essentiality

    • Generation of reporter fusions to monitor expression in real-time during infection

  • Microfluidic single-cell analysis: This approach enables the study of RnfE function and its impact on membrane potential at the single-cell level, revealing heterogeneity in bacterial populations that may contribute to persistence and pathogenicity.

  • Synthetic biology approaches: Engineering synthetic Rnf complexes with modified RnfE components can help determine minimal functional requirements and test hypotheses about ion selectivity and transport mechanisms.

  • High-throughput screening platforms: Development of assays based on membrane potential or growth in specific conditions can facilitate screening of compound libraries for RnfE inhibitors. Bacteriophage-based detection systems using GFP fusion proteins offer promising platforms for such screening efforts .

  • In vivo imaging techniques: Developing methods to visualize RnfE activity during infection using fluorescent probes could provide unprecedented insights into its role in pathogenesis.

  • Systems biology integration: Combining multi-omics data (transcriptomics, proteomics, metabolomics) to create comprehensive models of how RnfE function integrates with broader cellular processes during infection.

  • Phage therapy targeting: Developing engineered bacteriophages that can specifically target E. coli O157:H7 and deliver inhibitors of RnfE function represents a promising alternative to conventional antibiotics .

These approaches could lead to novel therapeutic strategies targeting RnfE, potentially disrupting E. coli O157:H7 energy metabolism during infection without affecting commensal microbiota.

How might understanding RnfE function contribute to developing new detection methods or treatments for E. coli O157:H7 infections?

Understanding RnfE function opens several avenues for innovative detection and treatment approaches:

  • Enhanced detection methods:

    • RnfE-specific aptamer development: Selecting DNA or RNA aptamers that bind specifically to RnfE could enable rapid, sensitive detection methods for E. coli O157:H7 in clinical and food samples.

    • Activity-based sensors: Creating fluorescent or electrochemical sensors that detect Rnf complex activity could provide functional detection methods that distinguish viable from non-viable pathogens.

    • Engineered bacteriophages: Further refinement of bacteriophage-based detection systems, such as the GFP-labeled PP01 phage, could integrate RnfE targeting for improved specificity and sensitivity .

  • Therapeutic interventions:

    • Small molecule inhibitors: Rational design of compounds that specifically inhibit RnfE function could disrupt energy metabolism in E. coli O157:H7, attenuating virulence without killing commensal bacteria.

    • Peptide-based approaches: Developing peptides that mimic critical interaction domains of RnfE could interfere with complex assembly and function.

    • Immunomodulatory strategies: Understanding how RnfE contributes to immune evasion could lead to approaches that enhance host immune detection and clearance of the pathogen.

  • Prevention strategies:

    • Vaccine development: Using recombinant RnfE or peptide epitopes as vaccine components could generate protective immunity, as demonstrated in studies using E. coli O157:H7 LPS conjugated to diphtheria toxoid .

    • Probiotic engineering: Creating probiotic strains that compete with E. coli O157:H7 for the same ecological niche but lack pathogenic potential could be achieved by engineering RnfE to optimize colonization while eliminating virulence.

    • Environmental interventions: Developing compounds that specifically target RnfE function for use in food processing or environmental decontamination.

  • Combination approaches:

    • Synergistic therapies: Combining RnfE inhibitors with conventional antibiotics or other virulence inhibitors could produce synergistic effects, reducing the required antibiotic dose and minimizing resistance development.

    • Theranostic approaches: Developing dual-function molecules that simultaneously detect and inhibit RnfE function could provide targeted treatment options.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.