Recombinant Escherichia coli O157:H7 Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
frdC; ECH74115_5670; Fumarate reductase subunit C; Fumarate reductase 15 kDa hydrophobic protein; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Target Names
frdC
Target Protein Sequence
MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGF VDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVA TIVILFVALYW
Uniprot No.

Target Background

Function
Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate: fumarate reductase (anaerobic growth) and succinate dehydrogenase (aerobic growth). FrdC anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.
Database Links
Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the frdABCD operon organization influence functional expression of fumarate reductase?

The frdABCD genes are organized in a single operon and must be expressed as a complete unit for proper function. Experimental evidence has demonstrated that:

Gene ComponentsFunctional OutcomeEnzymatic Activity
All four subunits (frdABCD)Functional complex, growth restorationComplete activity
frdA + frdB onlySoluble dimer formationActive in benzyl viologen oxidase assay
frdA or frdB aloneNo functional assemblyNo activity
frdC + frdDMembrane associationRequired for quinone oxidation
frdABC + frdD (separate plasmids)Impaired complex assemblyNo growth restoration

Research has shown that separation of the DNA coding for frdC and frdD proteins significantly affects the ability of fumarate reductase to assemble into a functional complex. This indicates that the spatial and temporal coordination of all four subunits is essential for proper enzyme assembly and function .

What are the optimal storage conditions for recombinant frdC protein?

For recombinant frdC protein stability and activity maintenance, the following storage conditions are recommended:

  • Primary storage: -20°C for routine use, -80°C for extended storage

  • Storage buffer: Tris-based buffer with 50% glycerol, optimized for protein stability

  • Working aliquots: Store at 4°C for up to one week to minimize freeze-thaw cycles

  • Avoid repeated freezing and thawing as this significantly reduces protein activity

These conditions are critical for maintaining the native conformation and functional properties of the recombinant protein .

What techniques are most effective for functional expression of recombinant frdC in heterologous systems?

For successful expression of functional recombinant frdC, several methodological approaches have proven effective:

High-Efficiency Fed-Batch Culture Method:

  • Media Composition: Use defined media with controlled carbon source availability

  • Growth Parameters: Implement exponential feeding strategy with the following guidelines:

    • Initial batch growth to deplete initial carbon source

    • Controlled carbon source feeding to maintain specific growth rate (μ) below 0.3 h⁻¹

    • Process temperature: 37°C initially, reduced to 30°C post-induction

  • Induction Protocol: Conservative induction to balance protein expression and cell viability

  • Monitoring Parameters: Track dissolved oxygen, pH, and cell density continuously

This approach can yield cell densities exceeding 50g dry cell weight per liter (gdcw/L), providing sufficient biomass for downstream purification of membrane proteins like frdC .

Expression System Considerations:

  • For membrane protein expression, C41(DE3) or C43(DE3) E. coli strains often provide better yields

  • Co-expression with chaperones may enhance proper folding

  • Fusion tags (His, GST) should be positioned to avoid disrupting membrane insertion

How does the expression of frdC differ between anaerobic and aerobic conditions?

Transcriptomic analysis of E. coli O157:H7 reveals significant differences in frdC expression between anaerobic and aerobic conditions:

ConditionfrdC ExpressionAssociated Genes UpregulatedPhysiological Context
AnaerobicUpregulatedcurli pili genes (csgBA, csgDEFG), adherence genes (ompA, tdcA, cadA), heat shock genes (dnaK, dnaJ, groEL, groES), σ38 (rpoS)Growth on fumarate as terminal electron acceptor
AerobicDownregulatedTCA cycle genes, cytochrome componentsOxidative phosphorylation predominant

Under anaerobic conditions, the frd operon is induced to facilitate fumarate respiration, with approximately 419 genes differentially expressed compared to aerobic growth. This regulation is part of a broader metabolic shift that occurs when oxygen becomes limiting .

The anaerobic upregulation of frdC is physiologically significant as it allows E. coli O157:H7 to colonize the gastrointestinal tract where oxygen is limited, potentially contributing to its pathogenicity .

What are the methodological approaches for studying the membrane topology and interactions of frdC?

Several advanced techniques can be employed to study frdC membrane topology and interactions:

Membrane Topology Analysis:

  • Substituted Cysteine Accessibility Method (SCAM):

    • Systematically replace native amino acids with cysteine residues

    • Probe accessibility with membrane-permeable and impermeable sulfhydryl reagents

    • Map topology based on differential labeling patterns

  • Fusion Protein Approach:

    • Create fusions with reporter proteins (GFP, PhoA, LacZ)

    • Reporter activity indicates subcellular localization

    • Generate comprehensive topology map through multiple fusion points

Protein-Protein Interaction Analysis:

  • Crosslinking Studies:

    • Apply membrane-permeable crosslinkers of varying lengths

    • Identify interaction partners through mass spectrometry

    • Verify specificity through site-directed mutagenesis

  • Blue Native PAGE:

    • Solubilize membrane complexes with mild detergents

    • Separate intact complexes by electrophoresis

    • Identify components through second-dimension SDS-PAGE or mass spectrometry

  • Co-purification Strategies:

    • Design affinity tags that don't disrupt membrane insertion

    • Implement tandem affinity purification to isolate intact complexes

    • Confirm interactions through reciprocal co-purification

These approaches provide complementary data to understand both the orientation of frdC within the membrane and its interactions with other fumarate reductase subunits .

How can genetic knockout experiments be optimized when targeting frdC in E. coli O157:H7?

Genetic knockout of frdC requires careful experimental design due to its role in anaerobic respiration and potential effects on metabolism. The following methodological approach is recommended:

Two-Step Recombination Strategy:

  • First Homologous Recombination:

    • Amplify a DNA fragment containing:

      • ~400 bp upstream of frdC

      • Selection marker (cat-sacB cassette)

      • ~400 bp downstream of frdC

    • Transform using electroporation (2.5 kV)

    • Select transformants on chloramphenicol plates (34 μg/mL)

    • Verify integration by PCR

  • Second Homologous Recombination:

    • Amplify a DNA fragment containing:

      • ~400 bp upstream of frdC

      • ~400 bp downstream of frdC (no selection marker)

    • Transform into first-step recombinants

    • Select on media containing 5% sucrose

    • Verify deletion by PCR and sequencing

Critical Verification Steps:

  • PCR verification with primers flanking the deleted region

  • Functional verification through anaerobic growth assessment on glycerol and fumarate

  • RNA-seq or RT-PCR to confirm absence of frdC transcripts

  • Complementation studies to verify phenotype specificity

This approach minimizes polar effects on adjacent genes within the frd operon and allows precise characterization of frdC-specific functions .

What transcriptomic approaches provide the most insight into frdC regulation under different environmental conditions?

Comprehensive transcriptomic analysis of frdC regulation can be achieved through the following methodological framework:

RNA Isolation Optimization:

  • For anaerobic cultures: Harvest cells in an anaerobic chamber to prevent oxygen-induced expression changes

  • Quick-freeze samples in liquid nitrogen to capture exact transcriptional state

  • Use hot phenol extraction method to maximize RNA recovery from membrane-associated ribosomes

Transcriptome Analysis Pipeline:

  • Experimental Design:

    • Include biological triplicates for statistical robustness

    • Implement factorial design to test multiple variables (oxygen, pH, carbon source)

    • Include time-course sampling to capture dynamic responses

  • Data Analysis Workflow:

    • Normalize using both internal controls and spike-in standards

    • Apply appropriate statistical models (ANOVA, DESeq2, edgeR)

    • Set significance thresholds (p < 0.014 with false discovery rate < 10%)

    • Validate key findings with RT-qPCR

Research has shown that under anaerobic conditions, frdC is co-regulated with genes involved in adherence, stress response, and alternative carbon metabolism, suggesting integration with broader physiological adaptations .

How can recombinant frdC be leveraged for developing detection methods for E. coli O157:H7?

Recombinant frdC protein can be utilized for developing sensitive and specific detection methods for E. coli O157:H7 through the following approaches:

Antibody-Based Detection Systems:

  • Generate high-affinity monoclonal antibodies against unique epitopes of frdC

  • Develop ELISA-based detection systems with sensitivity down to 1-10 CFU/mL

  • Implement lateral flow immunoassays for rapid field detection

Nucleic Acid-Based Detection:

  • Isothermal Amplification Methods:

    • Recombinase Polymerase Amplification (RPA) targeting frdC gene

    • Optimize reaction parameters: 10 μL minimum volume, 10-minute incubation, 39-42°C temperature range

    • Couple with lateral flow dipstick (LFD) for visual detection

This approach has demonstrated high sensitivity (down to 1 fg genomic DNA) and specificity for E. coli O157:H7 in complex food matrices such as raw milk, with a limit of detection of 4.4 CFU/mL .

Bacteriophage-Based Detection:

  • Engineer recombinant bacteriophages expressing reporter genes upon specific binding to E. coli O157:H7

  • Implement 5-hour enrichment protocol followed by phage infection

  • Detect reporter signal (luminescence or colorimetric)

This approach can detect as little as 1 CFU/25g of sample within 7.5 hours, providing a rapid alternative to traditional culturing methods .

What are the most effective strategies for optimizing cell transfection when working with frdC expression constructs?

When transfecting cells with frdC expression constructs, particularly for membrane protein expression, a systematic design of experiments (DoE) approach should be implemented:

Critical Factors to Optimize:

  • DNA Construct Design:

    • Codon optimization for expression host

    • Fusion partners to aid membrane insertion

    • Promoter strength appropriate for membrane protein expression

  • Transfection Parameter Optimization:

FactorTested RangeOptimal ConditionEffect on Expression
PEI TypeLPEI22, LPEI25LPEI22Improved membrane protein delivery
PEI Concentration5-7 μg/mL6.5 μg/mLHigher concentrations increase toxicity
DNA Concentration0.5-2 μg/mL1 μg/mLBalanced expression without aggregation
Cell Density15,000-35,000 cells/cm²25,000 cells/cm²Ensures optimal cell-cell contact
PEI:DNA Ratio3:1 - 8:16.5:1Critical for complex formation and uptake
  • Post-Transfection Conditions:

    • Temperature shift to 30°C to aid membrane protein folding

    • Addition of chemical chaperones (glycerol, DMSO)

    • Optimize harvest timing to balance expression and toxicity

This methodical approach has been demonstrated to significantly increase transfection efficiency for difficult-to-express membrane proteins, with improvements of up to 3-fold compared to standard protocols .

How does the structure-function relationship of frdC influence E. coli O157:H7 pathogenicity?

The connection between frdC function and pathogenicity appears to be linked to metabolic adaptation in the host environment:

  • Anaerobic Adaptation: Transcriptome analysis reveals that under anaerobic conditions (similar to the intestinal environment), frdC is co-expressed with virulence-associated genes located in O-islands specific to E. coli O157:H7 .

  • Acid Resistance Connection: The frd operon expression correlates with activation of acid resistance systems, particularly the glutamate-dependent AR system, which is critical for survival in the acidic stomach environment .

  • Biofilm Formation: frdC expression is linked to genes associated with biofilm formation, including curli pili genes (csgBA, csgDEFG), suggesting a potential role in host colonization .

Methodological approaches to investigate these connections include:

  • Construction of isogenic mutants with precise deletions in frdC

  • Animal colonization models comparing wild-type and frdC mutants

  • Transcriptome and proteome analysis of host-pathogen interactions

  • Microscopy techniques to visualize bacterial localization in host tissues

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.