Recombinant Escherichia coli O157:H7 Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Escherichia coli O157:H7 Fumarate Reductase Subunit D (FrdD)

Escherichia coli O157:H7 is a Shiga toxin-producing bacterium that causes severe gastrointestinal disease in humans . Fumarate reductase (FRD) is an enzyme complex that plays a vital role in the anaerobic respiratory pathways of E. coli, including E. coli O157:H7 . The FRD complex consists of four subunits (FrdA, FrdB, FrdC, and FrdD), each with a distinct function . FrdD is one of two integral membrane proteins in the fumarate reductase complex .

FrdD Structure and Function

The FrdD subunit, along with FrdC, anchors the catalytic subunits (FrdA and FrdB) to the inner membrane . FrdC and FrdD each have three transmembrane helices connected by periplasmic loops; the N-terminus is located in the cytoplasm and the C-terminus is located in the periplasm . These transmembrane helices create two menaquinone-binding pockets .

Despite similar function, hydrophobicity, and protein size, the FrdC and FrdD subunits of fumarate reductase do not share significant sequence identity with the corresponding membrane-binding subunits of succinate dehydrogenase, SdhC and SdhD .

Table 1: Key Features of FrdD

FeatureDescription
GenefrdD
Accession NumbersEG10332 (MetaCyc), b4152, ECK4148
Locationsinner membrane
Sequence Length131 AAs
Molecular Weight15.015 kD (from nucleotide sequence)
Biological ProcessCellular respiration, anaerobic respiration
Molecular FunctionMenaquinone binding
Cellular ComponentInner membrane
MultiFun Termscell structure → membrane; metabolism → energy metabolism, carbon → anaerobic respiration; metabolism → energy metabolism, carbon → fermentation; metabolism → energy production/transport → electron acceptors
Unification LinksDIP:DIP-48082N, EcoliWiki:b4152, Mint:MINT-1290104, ModBase:P0A8Q0, PR:PRO_000022688, Protein Model Portal:P0A8Q0, RefSeq:NP_418576, SMR:P0A8Q0, UniProt:P0A8Q0

Role in Anaerobic Respiration

FRD catalyzes the reduction of fumarate to succinate, the reverse reaction of succinate dehydrogenase . This activity is essential for anaerobic growth, where fumarate serves as the terminal electron acceptor . The process involves a chain of redox cofactors organized in the sequence FAD - 2Fe:2S - 4Fe:4S - 3Fe:4S - Qp - Qd .

Fumarate Reductase and Succinate Dehydrogenase Activity Assays

Fumarate reductase activity can be measured by monitoring the oxidation kinetics of benzyl viologen at 585 nm in an anaerobic environment . Succinate dehydrogenase activity is assessed by measuring the reduction kinetics of DCPIP (2,6-dichlorophenolindophenol) at 600 nm .

Table 2: Fumarate Reductase and Succinate Dehydrogenase Activities in C. jejuni

StrainFumarate Reductase Activity (nmol/min/mg)Succinate Dehydrogenase Activity (μmol/min/mg)
Wild TypeData not availableData not available
frdA::cat+Data not availableUnable to oxidize succinate
sdhA::cat+Data not availableData not available

Interactions and Regulation

FrdD interacts with other proteins and molecules, as detected by methods such as yeast two-hybrid assays, co-immunoprecipitation (co-IP), and pull-down assays . Fumarate reductase is composed of 4 subunits; the complex contains a cytoplasmic catalytic domain - FrdAB - containing bound flavin cofactor and three iron-sulfur clusters and a membrane anchor domain (FrdCD) which contains the quinol binding site(s) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
frdD; ECH74115_5669; Fumarate reductase subunit D; Fumarate reductase 13 kDa hydrophobic protein; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Target Names
frdD
Target Protein Sequence
MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is utilized during anaerobic growth, while succinate dehydrogenase functions in aerobic growth. FrdD anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How do recombinant frdD expression systems compare across different host organisms?

When expressing recombinant frdD, the choice of expression system significantly impacts protein yield and functionality:

Expression HostAdvantagesLimitationsTypical Yield
E. coli expression systemsHigh yield, rapid growth, straightforward purification via His-tagPotential membrane protein folding issues10-15 mg/L culture
Yeast systemsBetter for membrane proteins, post-translational modificationsLower yield, more complex media requirements2-5 mg/L culture
Insect cell systemsSuperior folding for complex membrane proteinsHigher cost, longer production time1-3 mg/L culture

For optimal results when expressing in E. coli, the protein should be fused to an N-terminal His-tag to facilitate purification . The recombinant protein requires careful buffer formulation, typically using Tris/PBS-based buffer with 6% Trehalose at pH 8.0 for stability, and the addition of 50% glycerol for long-term storage at -20°C/-80°C to prevent freeze-thaw damage .

What are the recommended purification protocols for recombinant frdD?

Purification of recombinant frdD requires specialized approaches due to its hydrophobic nature:

  • Cell lysis: Gentle disruption with non-ionic detergents (0.1-1% n-dodecyl-β-D-maltoside) in Tris buffer (pH 8.0)

  • Initial purification: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged protein

  • Buffer composition: Include 0.05% detergent throughout purification to prevent aggregation

  • Secondary purification: Size exclusion chromatography to remove aggregates

  • Quality control: SDS-PAGE analysis (expect >90% purity)

  • Storage: Lyophilization or storage in buffer with 50% glycerol

Post-purification, reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL with glycerol added to prevent repeated freeze-thaw cycles .

How does the fumarate reductase system in E. coli O157:H7 differ from non-pathogenic E. coli strains?

Comparative analysis reveals several key differences in the fumarate reductase system between pathogenic E. coli O157:H7 and non-pathogenic strains:

CharacteristicE. coli O157:H7Non-pathogenic E. coli K-12
Expression regulationDistinct responses to environmental stressorsDifferent regulatory pattern
Acid resistanceEnhanced expression of acid fitness genesLower expression of acid fitness genes
Genetic contextContains O157:H7-specific horizontally transferred DNA (1.4 Mb)Lacks these genetic elements
Transcriptional responseDifferential expression profile to acid stressDifferent acid response pattern

Research shows that E. coli O157:H7 has unique transcriptomic responses that differ from K-12 strains, particularly in acid resistance mechanisms . This is significant because the O157:H7 strain carries 1.4 Mb of sequence absent from K-12 strains, most of which is horizontally transferred foreign DNA . These differences suggest that metabolic enzymes like fumarate reductase may function differently in the context of pathogenicity.

What is the optimal experimental design for studying frdD function in E. coli O157:H7?

To effectively study frdD function, researchers should implement a Framework for Reliable Experimental Design (FRED) approach with the following components:

  • Gene deletion and complementation studies:

    • Create clean frdD knockout using λ Red recombination system

    • Confirm deletion by PCR and sequencing

    • Complement with plasmid-expressed wild-type frdD

    • Include appropriate controls (wild-type and empty vector)

  • Growth condition variations:

    • Compare aerobic vs. anaerobic growth

    • Test different carbon sources (glucose, glycerol, succinate)

    • Vary pH conditions (pH 5.5-7.5)

    • Examine growth in bovine digestive contents

  • Activity assays:

    • Measure fumarate reductase activity spectrophotometrically by monitoring NADH oxidation at 340 nm

    • Assay conditions: 50 mM NaPO₄ buffer (pH 6.5), 20 mM fumarate, 0.2 mM NADH

    • Determine Km values for fumarate (0.01-20 mM range) and NADH (0.03-0.2 mM range)

    • Quantify succinate production via ion-exclusion chromatography

  • Controls and validation:

    • Include technical replicates (minimum n=3)

    • Biological replicates (minimum n=3)

    • Appropriate statistical analysis

This experimental design follows principles from Campbell and Stanley's framework for valid experimental inference, ensuring internal and external validity through proper controls and replication .

How do environmental factors affect frdD expression and function in E. coli O157:H7?

Environmental conditions significantly influence frdD expression patterns in E. coli O157:H7, especially during host colonization:

Environmental FactorEffect on frdD ExpressionMethod of Measurement
Oxygen availabilityUpregulated under anaerobic conditionsRNA-seq, qRT-PCR
pHComplex regulation under acidic conditionsTranscriptomic analysis
Digestive compartmentExpression varies from rumen to rectumIn vitro growth in bovine digestive contents
Short-chain fatty acidsModulation of expressionTotal SCFA measurement by GC

Research has demonstrated that E. coli O157:H7 shows differential growth patterns across bovine digestive compartments. In rumen content (pH decreasing to acidic conditions), population decreases by ≈0.5 log CFU mL⁻¹ after 8h of incubation, while in small intestine content, there is substantial growth (≈4 log CFU mL⁻¹ increase) . This suggests that fumarate metabolism genes like frdD may be regulated differently in response to these environmental conditions.

The concentration of short-chain fatty acids (SCFAs) also impacts bacterial metabolism, with total SCFA concentration being higher in rumen content than in other digestive compartments, potentially affecting fumarate reductase expression and activity .

What role does frdD play in the virulence mechanism of E. coli O157:H7?

While direct evidence linking frdD to virulence is limited, investigation of related metabolic pathways suggests significant involvement:

  • Metabolic adaptation and virulence:

    • Disruption of the succinate dehydrogenase complex (Sdh) attenuates EHEC toxicity

    • The SdhA enzyme converts succinate to fumarate (the reverse reaction of what FrdD participates in)

    • Fumarate depletion in sdhA mutants correlates with decreased virulence

    • Fumarate replenishment significantly increases virulence toward C. elegans

  • Regulatory effects:

    • Fumarate acts as a signaling molecule that regulates the expression of virulence factors

    • Tryptophanase (TnaA) has been identified as a downstream virulence determinant regulated by fumarate levels

  • Survival in host environments:

    • Growth patterns in bovine digestive contents suggest metabolic adaptation is critical for colonization

    • E. coli O157:H7 shows similar growth patterns to bovine commensal E. coli strains in various digestive compartments

These findings indicate that the fumarate metabolic pathway, including frdD, plays a crucial role in EHEC virulence, potentially through both energy production and regulatory functions.

How can multi-omic approaches enhance our understanding of frdD function?

Integrating multiple omics technologies provides comprehensive insights into frdD function:

  • Transcriptomics:

    • RNA-seq analysis comparing wild-type and frdD mutants under various conditions

    • Differential expression analysis to identify co-regulated genes

    • Example methodologies from EHEC studies in bovine digestive contents

  • Proteomics:

    • Label-free proteomic methods to identify downstream effectors

    • Identification of protein-protein interactions within the fumarate reductase complex

    • Analysis of post-translational modifications

  • Metabolomics:

    • Measurement of TCA cycle intermediates, particularly succinate and fumarate

    • Correlation between metabolite levels and virulence phenotypes

    • Integration with phenotypic data from infection models

  • Data integration approaches:

    • Correlation analysis between transcript, protein, and metabolite levels

    • Network analysis to identify regulatory relationships

    • Machine learning approaches to predict functional relationships

A successful example of multi-omic integration demonstrated that SdhA catabolite fumarate plays a critical role in EHEC virulence regulation, and identified TnaA as a downstream virulence determinant using label-free proteomic methods .

What methodological challenges exist when studying membrane-associated proteins like frdD?

Researchers face several technical challenges when investigating frdD:

  • Isolation challenges:

    • Hydrophobic nature requires specialized detergent-based extraction

    • Maintaining native conformation during purification

    • Preventing aggregation during concentration steps

  • Structural analysis limitations:

    • Difficulty obtaining crystals for X-ray crystallography

    • Challenges in NMR spectroscopy due to size and hydrophobicity

    • Need for specialized membrane mimetics for functional studies

  • Protein-protein interaction studies:

    • Traditional yeast two-hybrid systems often fail with membrane proteins

    • Need for specialized membrane-based two-hybrid systems

    • Difficulty distinguishing specific versus non-specific interactions

  • Functional reconstitution:

    • Reconstitution into artificial membrane systems required for activity assays

    • Variability in activity based on lipid composition

    • Need for proper orientation in the membrane

  • Recommended approaches:

    • Blue native PAGE for complex integrity analysis

    • Liposome reconstitution for functional studies

    • Crosslinking mass spectrometry for interaction studies

    • Cryo-electron microscopy for structural analysis

How does the RecD-Fumarate reductase relationship influence bacterial recombination and metabolism?

The interconnection between RecD (a subunit of RecBCD enzyme involved in DNA repair and recombination) and fumarate metabolism represents an understudied area with significant research implications:

  • Possible metabolic-recombination connections:

    • The RecD subunit inhibits recombination in E. coli until the enzyme acts at Chi sites

    • Metabolic stress conditions may influence RecBCD activity and RecD function

    • Deletion of recD in nuclease-deficient mutants (recB D1080A) restores recombination proficiency

  • Experimental evidence:

    • The RecD subunit inhibits DNA repair in the recB mutant, as demonstrated by mitomycin C sensitivity tests

    • RecD inhibits recombination in the recB D1080A mutant, as measured in Hfr conjugation and phage lambda crosses

    • These inhibitory effects could be influenced by metabolic conditions

  • Methodological approach for studying this relationship:

    • Create double mutants (frdD deletion in RecD backgrounds)

    • Examine recombination frequency under varying metabolic conditions

    • Measure fumarate and succinate levels in RecD mutants

    • Analyze transcriptomic profiles of recombination genes in response to metabolic shifts

This represents an advanced research question bridging DNA metabolism and central carbon metabolism, potentially revealing new regulatory mechanisms in bacterial physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.