Recombinant Escherichia coli O157:H7 NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Please note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development for your protein.
Synonyms
nuoK; ECH74115_3418; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Target Names
nuoK
Target Protein Sequence
MIPLQHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQV MYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the immediate electron acceptor for the enzyme is thought to be ubiquinone. The enzyme couples this redox reaction with proton translocation, transporting four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit K in E. coli O157:H7 and how does it relate to mitochondrial proteins?

The NuoK subunit is the Escherichia coli homologue of ND4L, which is the smallest mitochondrial DNA-encoded subunit of proton-translocating NADH-quinone oxidoreductase (complex I). In E. coli O157:H7, this membrane domain subunit plays a critical role in the coupling mechanism of the bacterial NADH-quinone oxidoreductase (NDH-1), contributing to the protein's electron transfer and proton translocation functions. The evolutionary relationship between bacterial NDH-1 and mitochondrial complex I provides valuable insights into respiratory chain development across species, with conserved functional domains suggesting crucial mechanistic similarities.

How does the nuoK gene fit within the genomic context of E. coli O157:H7?

The nuoK gene is part of the NDH-1 operon in the E. coli O157:H7 genome, which spans approximately 5.5 Mb. This genome includes a 4.1 Mb backbone sequence that is conserved across all E. coli strains, with the remaining segments specific to O157:H7. When compared to the non-pathogenic E. coli K-12 strain, O157:H7 shows a 0.53 Mb DNA reduction, suggesting that genomic reduction has played a role in the evolution of this pathogenic strain. The nuoK gene must be understood within this broader genomic context, which has been shaped by both horizontal gene transfer and gene loss events during the evolutionary history of E. coli O157:H7.

What techniques are most effective for site-directed mutagenesis of the nuoK gene in E. coli O157:H7?

For site-directed mutagenesis of the nuoK gene, homologous recombination techniques have proven most effective. This approach allows for precise targeting of specific amino acid residues within the nuoK gene sequence. The methodology involves:

  • Design of primers containing the desired mutation with appropriate flanking sequences

  • PCR amplification of the mutated fragment

  • Integration of the mutated fragment into the genome through homologous recombination

  • Selection and verification of successful recombinants

This technique has been successfully employed to target conserved glutamic acid residues and arginine residues in the nuoK gene, resulting in functional mutants that retain their ability to assemble into the complete NDH-1 complex while exhibiting altered activity profiles.

How can researchers effectively detect and isolate recombinant E. coli O157:H7 strains expressing modified nuoK?

Detection and isolation of recombinant E. coli O157:H7 strains expressing modified nuoK can be accomplished through a multi-step approach:

  • Initial screening on Sorbitol MacConkey (SMAC) agar supplemented with 4-methyl-umbelliferyl-D-glucuronide (MUG) to identify E. coli O157:H7 based on its unique characteristics of delayed D-sorbitol fermentation (>24h) and inability to produce β-glucuronidase

  • Addition of selective agents such as cefixime, potassium tellurite, and vancomycin to increase specificity

  • Confirmation of O157 and H7 serotypes using latex agglutination assays

  • Verification of nuoK modifications through sequencing

  • Assessment of NDH-1 complex assembly using blue-native gel electrophoresis

  • Functional characterization through activity assays

This methodological approach ensures accurate identification and characterization of E. coli O157:H7 strains carrying the desired nuoK modifications.

What assays are most appropriate for measuring the electron transfer and proton translocation activities of nuoK mutants?

The assessment of nuoK mutant functionality requires specialized assays targeting both electron transfer and proton translocation activities:

Assay TypeMethodologyMeasured ParametersAdvantages
Coupled electron transferNADH oxidation spectrophotometryNADH oxidation rate with various electron acceptorsDirectly measures primary enzymatic function
Electrochemical gradient generationMembrane potential-sensitive fluorescent probesDevelopment and maintenance of membrane potentialAssesses coupling between electron transfer and proton movement
Proton translocationpH-sensitive fluorescent indicatorsProton movement across the membraneDirectly measures the consequence of nuoK function
Blue-native gel electrophoresisProtein complex separation under non-denaturing conditionsComplex assembly and stabilityConfirms structural integrity of the NDH-1 complex

How do mutations in conserved glutamic acid residues of nuoK affect the coupling mechanism of NDH-1?

Mutations in the highly conserved glutamic acid residues (Glu-36 and Glu-72) of the nuoK subunit have profound effects on the coupling mechanism of NDH-1:

  • Mutations of nearly perfectly conserved Glu-36 lead to almost complete loss of coupled electron transfer activity

  • This loss of activity is accompanied by failure to generate an electrochemical gradient

  • Mutations of Glu-72, another highly conserved residue, result in significant diminution of coupled activities, though to a lesser extent than Glu-36 mutations

  • Despite these functional defects, the NDH-1 complex remains fully assembled as detected by blue-native gel electrophoresis and immunostaining

These findings suggest that both membrane-embedded acidic residues are critical for the coupling mechanism of NDH-1, likely serving as proton carriers or forming part of the proton translocation pathway. The differential effects of mutations at these two positions indicate distinct but complementary roles in the proton translocation process, with Glu-36 appearing to be more central to the coupling mechanism.

What is the significance of arginine residues on the cytosolic loop of nuoK for NDH-1 function?

The arginine residues located on the cytosolic loop of nuoK play a crucial role in NDH-1 function:

  • Severe impairment of coupled activities occurs when two vicinal arginine residues on the cytosolic loop are simultaneously mutated

  • Single mutations of these residues produce less dramatic effects, suggesting functional redundancy

  • The positively charged nature of these residues likely contributes to substrate binding or interaction with other subunits of the complex

  • These arginine residues may also participate in maintaining the proper conformation of the cytosolic loop, which is essential for the mechanical aspects of proton translocation

The spatial arrangement of these positively charged residues relative to the membrane-embedded glutamic acids creates an electrostatic environment that may facilitate proton movement through the complex. This arrangement highlights the importance of charge distribution in the coupling mechanism of NDH-1.

How does the nuoK subunit contribute to the acid resistance mechanisms in E. coli O157:H7?

While the primary function of nuoK relates to energy metabolism through NADH-quinone oxidoreductase activity, its role may indirectly influence the acid resistance (AR) mechanisms in E. coli O157:H7:

  • E. coli O157:H7 possesses three overlapping AR systems that enable survival in acidic environments

  • The first AR system requires the alternative sigma factor RpoS and glucose repression

  • The second AR system requires arginine during exposure to acidic conditions and involves arginine decarboxylase (adiA)

  • The third AR system requires glutamate for protection at low pH and involves glutamate decarboxylase (gadA or gadB)

The energy-transducing function of NDH-1, to which nuoK contributes, may support these AR systems by maintaining the proton motive force necessary for various cellular functions under stress conditions. Additionally, the proton translocation activity of NDH-1 might interact with cellular pH homeostasis mechanisms, potentially influencing the effectiveness of AR systems in pathogenic E. coli strains.

What controls should be included when studying recombinant nuoK variants in E. coli O157:H7?

A comprehensive study of recombinant nuoK variants requires several levels of controls:

Control TypePurposeImplementation
Positive genetic controlVerify recombination systemIntroduce a neutral marker mutation with known phenotype
Wild-type controlBaseline for comparisonParallel analysis of unmodified E. coli O157:H7
Complementation controlConfirm phenotype causalityReintroduce wild-type nuoK gene to mutant strains
Assembly controlVerify complex formationBlue-native PAGE and immunostaining of NDH-1 complex
Functional controlAssess specific activity impactMutations in adjacent but non-conserved residues
Negative controlEstablish complete loss referenceDeletion of entire nuoK gene

These controls ensure that observed phenotypes are specifically attributable to the introduced mutations rather than to experimental artifacts or secondary effects. Particularly crucial is the assembly control, as demonstrated by research showing that nuoK mutations can maintain full complex assembly while exhibiting functional defects.

How should experimental data on nuoK mutants be organized and presented for maximum interpretability?

Effective organization and presentation of experimental data on nuoK mutants should follow a comprehensive tabular approach:

Data CategoryOrganization StructureVisualization MethodPurpose
Mutation inventoryList of all mutations with amino acid positions and substitutionsData inventory tableDocument all genetic variants analyzed
Assembly dataCategorization by mutation type and complex assembly statusConcept-evidence table with gel imagesDemonstrate structural integrity of complexes
Activity measurementsComparison of electron transfer rates across mutantsCross-case analysis table with statistical significanceHighlight functional differences between variants
Proton translocationTemporal measurements of proton movementTemporally ordered table with gradient formation kineticsReveal coupling efficiency differences
Structure-function relationshipsCorrelation between mutation location and functional impactTypologically ordered tableIdentify critical domains and residues

This structured presentation enhances trustworthiness in qualitative research by allowing readers to analyze data from various perspectives and displaying evidence in a succinct and convincing manner. Particularly important is the use of tables to organize and condense data, facilitate analysis from multiple perspectives, and effectively display evidence to support findings.

How can apparent contradictions in nuoK mutant phenotypes be reconciled with current structural models?

Researchers may encounter seemingly contradictory data when analyzing nuoK mutants, particularly when functional defects occur without structural disruption of the NDH-1 complex. These apparent contradictions can be reconciled through careful consideration of:

  • Distinction between structural and functional roles of conserved residues

  • Recognition that subtle conformational changes may not affect assembly but can impact dynamic processes

  • Consideration of long-range interactions within the complex that may compensate for local disruptions

  • Analysis of the energetic landscape of the proton translocation pathway

For example, mutations in membrane-embedded glutamic acids (Glu-36 and Glu-72) maintain complex assembly while severely impairing function, suggesting these residues participate directly in proton translocation rather than structural stabilization. Similarly, simultaneous mutations of cytosolic arginine residues disrupt function without preventing complex formation, indicating their involvement in dynamic rather than static aspects of NDH-1 operation.

What evolutionary insights can be gained from comparing nuoK sequences across pathogenic and non-pathogenic E. coli strains?

Comparative analysis of nuoK sequences provides valuable evolutionary insights:

  • The nuoK gene exists within the context of the E. coli O157:H7 genome, which shows evidence of both acquisition and loss of DNA compared to non-pathogenic strains

  • While virulence-associated genes between sequenced E. coli O157:H7 strains are nearly identical (99%), differences in metabolic genes like nuoK may contribute to fitness in different environments

  • Analysis of G+C content can indicate horizontal gene transfer events that may have influenced nuoK evolution

  • Comparison with the 463 phage-associated genes in E. coli O157:H7 (versus only 29 in E. coli K-12) provides context for understanding the evolutionary forces acting on the entire genome

Such evolutionary analysis connects the functional characteristics of nuoK to the broader adaptive strategies of pathogenic E. coli strains, potentially revealing how metabolic adaptations contribute to virulence or survival in specific host environments.

How might nuoK function interact with the unique acid resistance systems of E. coli O157:H7 during host infection?

The potential interaction between nuoK function and acid resistance (AR) systems represents a complex research question with significant implications for understanding E. coli O157:H7 pathogenesis:

  • The energy-transducing activity of NDH-1, to which nuoK contributes, may support AR systems by providing ATP or maintaining membrane potential

  • Proton translocation by NDH-1 could influence cellular pH homeostasis, affecting the threshold at which AR systems are activated

  • The glutamate-dependent AR system (involving gadA/gadB) may interact with electron transport chain components through shared metabolic intermediates

  • Changes in nuoK function could alter the bacterial response to pH shifts encountered during passage through the gastrointestinal tract

Research exploring these interactions would need to examine both wild-type and nuoK mutant strains under various acid stress conditions, potentially using in vivo infection models to assess the consequences for bacterial survival and virulence. Such studies could reveal how metabolic adaptations contribute to the remarkable acid tolerance of this pathogen.

What emerging technologies could advance our understanding of nuoK's role in proton translocation?

Several cutting-edge technologies show promise for deepening our understanding of nuoK's function:

  • Cryo-electron microscopy for high-resolution structural determination of NDH-1 complex with various nuoK mutations

  • Single-molecule FRET to track conformational changes during catalytic cycles

  • Real-time proton flux measurements using nanoscale pH sensors

  • Molecular dynamics simulations to model proton pathways through the membrane domain

  • In situ cross-linking combined with mass spectrometry to identify dynamic interaction partners

These approaches would provide unprecedented insight into the mechanistic details of how this small subunit contributes to the complex process of coupling electron transfer to proton translocation across the bacterial membrane.

How might understanding nuoK function contribute to novel antimicrobial strategies against E. coli O157:H7?

The critical role of nuoK in energy metabolism suggests several potential antimicrobial approaches:

  • Development of small-molecule inhibitors targeting the conserved glutamic acid residues essential for proton translocation

  • Peptide-based therapies designed to disrupt interactions between nuoK and other subunits of the NDH-1 complex

  • Strategies to uncouple electron transfer from proton translocation, depleting bacterial energy reserves

  • Compounds that exploit the interaction between energy metabolism and acid resistance systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.