Recombinant Escherichia coli O157:H7 p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Description

Definition of Recombinant Escherichia coli O157:H7 p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Escherichia coli O157:H7 is a member of enterohemorrhagic E. coli (EHEC) that causes hemorrhagic colitis in humans . Symptoms of E. coli O157:H7 infection include severe abdominal cramps and diarrhea, which can be bloody and can lead to death . In children under the age of five, infection can lead to hemolytic uremic syndrome (HUS), resulting in red blood cell destruction, renal failure, and central nervous system complications . The infectious dose can be as low as 10 - 100 cells .

AaeA, formerly known as YhcQ, is a membrane fusion protein family member . AaeA is part of the AaeAB efflux pump, which contributes to aromatic carboxylic acid efflux . The AaeAB efflux pump system includes AaeR, AaeX, AaeA, and AaeB, which were previously named yhcS, yhcR, yhcQ, and yhcP, respectively .

Function and Mechanism

The AaeAB efflux pump likely functions as a metabolic relief valve to alleviate the toxic effects of imbalanced metabolism . The expression of the AaeAB efflux system is highly regulated, suggesting a specific physiological role .

Research Findings

  • Efflux Pump Characterization Treatment of E. coli with p-hydroxybenzoic acid (pHBA) upregulates yhcP, which encodes a protein of the putative efflux protein family. Also upregulated were the adjacent genes yhcQ, which encodes a protein of the membrane fusion protein family, and yhcR, which encodes a small protein without a known or suggested function .

  • Role of YhcS The function of the upstream, divergently transcribed gene yhcS, encoding a regulatory protein of the LysR family, in regulating expression of yhcRQP was demonstrated. Several aromatic carboxylic acid compounds serve as inducers of yhcRQP expression .

  • Efflux Function The efflux function encoded by yhcP was proven by the hypersensitivity to pHBA of a yhcP mutant strain. A yhcS mutant strain was also hypersensitive to pHBA. Expression of yhcQ and yhcP was necessary and sufficient for suppression of the pHBA hypersensitivity of the yhcS mutant .

  • Substrate Specificity Only a few aromatic carboxylic acids of hundreds of diverse compounds tested were defined as substrates of the YhcQP efflux pump .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
aaeA; ECH74115_4558; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Target Names
aaeA
Target Protein Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQ VNVHNQLVKKGQVLFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMSR EEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGST AVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTRD DKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFRK MAHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the genomic context of the aaeA gene in E. coli O157:H7?

The aaeA gene (formerly known as yhcQ) is part of the aaeXAB operon in E. coli. This operon consists of three adjacent genes: aaeX (formerly yhcR), aaeA (formerly yhcQ), and aaeB (formerly yhcP). The operon is regulated by the divergently transcribed aaeR gene (formerly yhcS), which encodes a regulatory protein of the LysR family. The genomic organization places aaeR upstream and in the opposite orientation to the aaeXAB operon .

In E. coli O157:H7, this genomic region is part of the 4.1 Mb backbone sequence conserved across all E. coli strains. While E. coli O157:H7 has acquired numerous horizontally transferred genes that contribute to its pathogenicity, the aaeXAB operon represents core E. coli functionality rather than O157:H7-specific virulence factors .

How was the AaeA gene originally identified and characterized?

The AaeA gene was initially identified during studies investigating E. coli's response to p-hydroxybenzoic acid (pHBA). Researchers observed that treatment with pHBA resulted in significant upregulation of several adjacent genes, originally designated as yhcQ, yhcP, and yhcR. Further characterization revealed that yhcQ encodes a protein of the membrane fusion protein family that works in conjunction with yhcP, which encodes a protein of the putative efflux protein family .

The function of this system was conclusively demonstrated through mutant studies, where a yhcP mutant strain showed hypersensitivity to pHBA. Expression of both yhcQ and yhcP was necessary and sufficient to suppress this hypersensitivity in a yhcS mutant. Based on their function in aromatic carboxylic acid efflux, the genes were renamed to aaeA (for yhcQ), aaeB (for yhcP), aaeX (for yhcR), and aaeR (for yhcS) .

What is the specific role of AaeA in p-hydroxybenzoic acid efflux?

AaeA functions as the membrane fusion protein component of the AaeAB efflux system, which specifically transports aromatic carboxylic acids, including p-hydroxybenzoic acid (pHBA). In this two-component system, AaeA (the membrane fusion protein) works in concert with AaeB (the efflux protein) to form a functional complex that actively exports specific substrates from the bacterial cell .

When testing the function of this system, researchers demonstrated that expression of both aaeA and aaeB was necessary for the effective efflux of pHBA and the suppression of pHBA hypersensitivity in mutant strains. The narrow substrate specificity of this pump distinguishes it from other efflux systems, as it primarily transports several aromatic hydroxylated carboxylic acids .

Experimental data showing AaeAB substrate specificity:

CompoundEfflux ActivityRelative Efficiency
p-hydroxybenzoic acidHigh+++
Similar aromatic carboxylic acidsModerate++
Other diverse compounds testedNegligible-

Note: The table represents a synthesis of findings reported in the literature .

How should researchers design expression systems for recombinant AaeA production?

When designing expression systems for recombinant AaeA production, researchers should consider several critical factors:

  • Vector selection: For membrane-associated proteins like AaeA, vectors with tightly controlled promoters (such as pET systems) are recommended to prevent toxicity during overexpression.

  • Expression host: While standard E. coli laboratory strains (such as BL21(DE3)) can be used, it's important to consider that endogenous AaeA may interfere with functional studies. Using an aaeA knockout strain as the expression host can provide cleaner experimental results.

  • Fusion tags: Adding a C-terminal His-tag or other affinity tag facilitates purification without disrupting the N-terminal membrane-association domain. Position-specific effects of tags should be empirically determined.

  • Induction conditions: Low-temperature induction (16-20°C) and reduced inducer concentrations often yield better results for membrane-associated proteins.

  • Co-expression considerations: For functional studies, co-expression with AaeB may be necessary since both proteins form a functional complex.

The expression system should be validated through Western blotting and functional assays measuring efflux activity against pHBA to ensure the recombinant protein is properly expressed and functional.

How is the expression of aaeA regulated in E. coli O157:H7?

The expression of aaeA is primarily regulated by AaeR, a transcriptional regulator of the LysR family encoded by the divergently transcribed aaeR gene. AaeR functions as a positive regulator that is activated in the presence of aromatic carboxylic acids, particularly pHBA .

The regulatory mechanism involves:

  • Inducer binding: Aromatic carboxylic acids bind to AaeR, causing a conformational change.

  • Promoter interaction: The activated AaeR binds to the promoter region upstream of the aaeXAB operon.

  • Transcriptional activation: This binding facilitates RNA polymerase recruitment and initiates transcription.

Experimental evidence demonstrates that a yhcS (aaeR) mutant strain exhibits hypersensitivity to pHBA, similar to a yhcP (aaeB) mutant, indicating the critical role of proper regulation in the efflux system's function .

Additionally, environmental factors such as growth phase, nutrient availability, and stress conditions can influence aaeA expression, often in coordination with biofilm formation where aaeXAB genes show significant upregulation .

What experimental methods are most effective for studying aaeA expression patterns?

To effectively study aaeA expression patterns, researchers should consider a multi-faceted approach:

  • Transcriptional reporter fusions: Constructing promoter-reporter fusions (using GFP, lacZ, or luciferase) allows real-time monitoring of aaeA promoter activity under various conditions. This approach is particularly useful for identifying environmental triggers of expression.

  • RT-qPCR analysis: For quantitative measurement of aaeA transcript levels, RT-qPCR provides high sensitivity. Primer design should be specific to distinguish aaeA from other membrane fusion protein-encoding genes.

  • RNA-seq: For genome-wide expression context, RNA-seq can reveal co-regulated genes and global regulatory networks affecting aaeA expression.

  • Western blotting: Using antibodies against AaeA or epitope-tagged versions can quantify protein levels and post-transcriptional regulation.

  • Chromatin immunoprecipitation (ChIP): This technique can identify direct binding of AaeR or other transcription factors to the aaeA promoter region.

When designing these experiments, researchers should include appropriate controls:

  • Positive control: pHBA treatment (known inducer)

  • Negative control: aaeR knockout strain

  • Reference genes/proteins: For normalization in qPCR and Western blot experiments

How does AaeA contribute to E. coli O157:H7 biofilm formation?

The AaeAB efflux system plays a significant role in biofilm formation in E. coli. Studies have shown that genes in the aaeXAB operon are significantly upregulated during biofilm growth compared to planktonic growth. This upregulation was among the highest observed when comparing expression profiles of various efflux pumps and transport genes in biofilms .

The functional connection between AaeAB and biofilm formation appears to be related to its role as a "metabolic relief valve." During biofilm formation, cells experience altered metabolic states due to oxygen and nutrient gradients within the biofilm structure. This can lead to the accumulation of metabolic intermediates, including aromatic compounds like pHBA, which is an intermediate in ubiquinone biosynthesis .

The AaeAB pump likely prevents toxic accumulation of these metabolites by efficiently exporting them from the cell. Without this function, metabolite accumulation could impair cellular functions critical for biofilm development and maintenance .

What methodological approaches should be used to investigate AaeA's role in biofilm formation?

To thoroughly investigate AaeA's role in biofilm formation, researchers should employ the following methodological approaches:

  • Genetic approaches:

    • Create precise aaeA deletion mutants using lambda Red recombination or CRISPR-Cas9

    • Complement the mutation with plasmid-expressed wild-type aaeA

    • Create point mutations in functional domains to identify critical residues

  • Biofilm quantification methods:

    • Crystal violet staining for total biomass quantification

    • Confocal laser scanning microscopy (CLSM) for structural analysis

    • Flow cell systems for dynamic biofilm formation

    • Viability staining to assess spatial distribution of live/dead cells

  • Metabolite profiling:

    • LC-MS/MS to measure intracellular and extracellular pHBA and related metabolites

    • Isotope labeling to track metabolite flow through relevant pathways

  • Transcriptional analysis:

    • RNA-seq comparing wild-type and aaeA mutant biofilms at different developmental stages

    • Promoter-reporter fusions to track spatial expression patterns within biofilms

  • Experimental design considerations:

    • Multiple time points (24h, 48h, 72h, 96h)

    • Various surface materials (glass, polystyrene, silicone)

    • Different media compositions to alter metabolic states

    • Flow vs. static conditions

Biofilm ParameterWild-typeΔaaeA MutantComplemented Strain
Biomass (OD590)1.45 ± 0.150.62 ± 0.111.32 ± 0.18
Surface coverage (%)85.3 ± 7.234.8 ± 5.679.1 ± 8.3
Average thickness (μm)42.5 ± 3.818.3 ± 2.438.7 ± 4.1
Intracellular pHBA (μM)2.3 ± 0.48.7 ± 1.22.8 ± 0.5

Note: This table represents hypothetical data based on similar studies of efflux pumps in biofilm formation.

What are the current challenges in studying AaeA-substrate interactions?

Investigating AaeA-substrate interactions presents several significant challenges that researchers must address:

  • Membrane protein crystallization barriers:

    • AaeA, as a membrane fusion protein, is difficult to crystallize due to its hydrophobic domains

    • Traditional X-ray crystallography approaches have limited success with membrane proteins

    • Alternative approaches like cryo-EM may be more suitable but require specialized equipment

  • Functional reconstitution complexities:

    • AaeA functions in complex with AaeB

    • Reconstituting the functional complex in vitro requires appropriate lipid environments

    • Maintaining native protein-protein interactions during purification is challenging

  • Substrate binding site identification:

    • The precise binding sites for pHBA and other substrates remain poorly characterized

    • Multiple potential interaction points may exist within the AaeA-AaeB complex

    • Distinguishing direct from indirect interactions requires specialized techniques

  • Technical limitations in transport assays:

    • Direct measurement of efflux in real-time presents technical challenges

    • Fluorescent substrate analogs may alter binding characteristics

    • Isolating the specific activity of AaeA from other efflux systems requires careful controls

  • Methodological approaches to address these challenges:

    • Site-directed spin labeling coupled with EPR spectroscopy

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Nanodiscs or liposome reconstitution systems

    • Computational docking and molecular dynamics simulations

    • FRET-based interaction assays with fluorescently labeled substrates

How can researchers effectively analyze contradictions in AaeA functional data?

When faced with contradictory results in AaeA functional studies, researchers should systematically analyze potential sources of discrepancy:

  • Strain-specific differences:

    • Compare genetic backgrounds (laboratory K-12 strains vs. pathogenic O157:H7 isolates)

    • Verify the complete genome sequence of strains used

    • Check for compensatory mutations that might affect phenotypes

  • Methodological variations:

    • Standardize growth conditions (media, temperature, aeration)

    • Use consistent substrate concentrations and exposure times

    • Adopt standardized protocols for efflux assays

  • Experimental design considerations:

    • Evaluate the specificity of phenotypic assays

    • Examine potential polar effects in genetic knockouts

    • Consider complementation controls with wild-type genes

  • Data analysis framework:

    Contradiction TypeAnalysis ApproachResolution Strategy
    Expression level discrepanciesCompare normalization methods, RNA preparation techniquesPerform absolute quantification with digital PCR
    Substrate specificity differencesExamine assay conditions, substrate purityConduct in vitro binding assays with purified components
    Phenotypic impact variationsAnalyze genetic background, growth conditionsCreate isogenic strains with single variable changes
    Structural model conflictsCompare modeling algorithms, reference structuresObtain experimental structural data (Cryo-EM, NMR)
  • Collaborative approaches:

    • Implement inter-laboratory validation studies

    • Share standardized materials (strains, plasmids, reagents)

    • Develop consensus protocols for key experimental procedures

How does AaeA function relate to E. coli O157:H7 acid resistance systems?

The relationship between AaeA function and E. coli O157:H7 acid resistance is complex and potentially significant for pathogenesis. E. coli O157:H7 possesses at least three distinct acid resistance (AR) systems that enable survival in acidic environments, such as the human stomach or acidified foods .

While AaeA is not directly part of the characterized AR systems, its function may complement acid resistance through:

  • Metabolic adaptation: The AaeAB efflux system helps maintain metabolic homeostasis by exporting potentially toxic aromatic compounds. During acid stress, metabolic pathways are altered, potentially leading to the accumulation of aromatic carboxylic acids that require efflux .

  • Biofilm-associated acid resistance: AaeA contributes to biofilm formation, and cells within biofilms often exhibit enhanced acid resistance. The biofilm matrix provides physical protection against acid stress, while the metabolic state of biofilm cells activates stress response mechanisms .

  • Indirect regulatory connections: The expression of aaeA and the AR systems may share regulatory elements. For example, RpoS (sigma factor 38) regulates one of the AR systems and also influences biofilm formation, potentially creating regulatory overlap .

Research investigating these connections should examine:

  • Expression patterns of aaeA under acid stress conditions

  • Acid survival of aaeA mutants compared to wild-type strains

  • Metabolomic profiles during acid adaptation

  • Potential interactions between AaeA and components of the AR systems

What experimental design would best evaluate AaeA's role in E. coli O157:H7 transmission from environmental sources?

To evaluate AaeA's role in E. coli O157:H7 transmission from environmental sources to hosts, a comprehensive experimental design should include:

  • Environmental survival and persistence studies:

    • Compare wild-type and ΔaaeA strains in soil and water microcosms

    • Measure survival under fluctuating temperature, pH, and nutrient conditions

    • Evaluate biofilm formation on relevant environmental surfaces (plant roots, soil particles)

  • Plant colonization model:

    • Use the established lettuce contamination model to assess transmission efficiency

    • Compare internal colonization ability of wild-type vs. ΔaaeA strains using confocal microscopy

    • Quantify bacterial populations at different plant tissue locations over time

    • Assess the impact of plant-derived aromatic compounds on aaeA expression

  • Animal colonization model:

    • Conduct competitive index experiments in animal models (typically mice or cattle)

    • Compare shedding patterns and persistence in the intestinal tract

    • Evaluate acid resistance during gastrointestinal passage

    • Measure biofilm formation on intestinal tissues

  • Molecular tracking approaches:

    • Use fluorescent protein-tagged strains for real-time visualization

    • Implement RNA-seq to identify transmission-associated gene expression patterns

    • Employ metabolomics to identify substrate changes during transmission

  • Data collection and analysis plan:

    Experimental PhaseMeasurementsAnalysis Methods
    Soil/water persistenceCFU/g or ml over time, gene expressionSurvival curve comparison, qPCR
    Plant colonizationInternal vs. surface populations, microscopy of tissue invasionConfocal imaging quantification, viable count comparison
    Animal colonizationFecal shedding levels, tissue colonization, competitive indexStatistical comparison of persistence, RNA-seq differential expression
    Molecular mechanismsTranscriptome during transmission, metabolite profilesPathway enrichment analysis, regulatory network reconstruction

This experimental design would provide comprehensive insights into AaeA's contribution to E. coli O157:H7 environmental persistence and transmission to hosts, while distinguishing between direct effects and indirect consequences through biofilm formation or metabolic adaptations.

How might AaeA function be leveraged for novel antimicrobial strategies?

Understanding AaeA function could open several promising avenues for antimicrobial development:

  • Efflux pump inhibitors (EPIs):

    • Design specific inhibitors targeting the AaeA-AaeB interaction interface

    • Develop compounds that compete with natural substrates for binding

    • Create allosteric inhibitors that prevent conformational changes necessary for efflux

  • Metabolic vulnerability exploitation:

    • Identify toxic metabolic intermediates normally exported by AaeAB

    • Develop compounds that increase production of these intermediates while blocking efflux

    • Target regulatory pathways that control aaeA expression

  • Biofilm prevention strategies:

    • Design interventions that disrupt AaeA's contribution to biofilm formation

    • Develop surface coatings that interfere with AaeA function

    • Create combination therapies targeting biofilm formation and efflux simultaneously

  • Research methodology considerations:

    • High-throughput screening assays for AaeA inhibitors

    • Structure-based drug design leveraging computational models

    • Whole-cell phenotypic screens with metabolomic analysis

    • In vivo infection models to validate efficacy

  • Potential advantages and limitations:

    ApproachAdvantagesLimitationsResearch Needs
    Direct AaeA inhibitionSpecific targeting, reduced resistance potentialNarrow spectrum activity, potential redundancyStructural characterization, binding site identification
    Metabolic targetingNovel mechanism of action, synergy with existing drugsComplex metabolic adaptations, off-target effectsComprehensive metabolic modeling, validation in diverse strains
    Biofilm disruptionAddresses persistent infections, enhances antibiotic efficacyStrain-specific biofilm mechanisms, delivery challengesBiofilm model standardization, in vivo efficacy studies

What are the most promising techniques for studying AaeA structure-function relationships?

Investigating AaeA structure-function relationships requires cutting-edge techniques that can overcome the challenges associated with membrane-associated proteins:

By integrating these complementary approaches, researchers can build a comprehensive understanding of AaeA structure-function relationships, potentially enabling rational design of inhibitors or modulators of efflux activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.