Recombinant Escherichia coli O157:H7 Phosphoglycerol transferase I (mdoB)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Mechanism

MdoB catalyzes the transfer of phosphoglycerol residues from phosphatidylglycerol to MDOs or β-glucoside acceptors (e.g., arbutin) via the reaction:
Phosphatidylglycerol + MDO → Phosphoglycerol-MDO + sn-1,2-diglyceride ( ).

  • Localization: Inner membrane, with the active site facing the periplasm ( ).

  • Role in MDO Biosynthesis: MDOs are periplasmic glucans modified with phosphoglycerol and succinyl residues. These modifications enable osmotic adaptation by maintaining turgor pressure under low-osmolarity conditions ( ).

  • Genetic Evidence: mdoB mutants fail to incorporate phosphoglycerol into MDOs, confirming the enzyme’s essential role ( ).

3.1. Functional Insights

  • Arbutin Resistance: Strains lacking dgk (diglyceride kinase) accumulate toxic diglycerides when exposed to arbutin. mdoB mutations suppress this toxicity by blocking phosphoglycerol transfer, enabling selection of resistant mutants ( ).

  • MDO Composition: MDOs from mdoB mutants contain <3% phosphoglycerol compared to wild-type MDOs ( ).

3.2. Genomic Context

  • Gene Location: mdoB maps near serB and thr at ~99 minutes on the E. coli chromosome ( ).

  • Operon Structure: Works alongside mdoGH (glucan backbone synthesis) and mdoC (succinyl transferase) ( ).

Applications in Research

  1. Osmoregulation Studies: Used to dissect how E. coli adapts to osmotic stress via MDO modification ( ).

  2. Enzyme Kinetics: Purified recombinant MdoB enables in vitro assays to study substrate specificity and inhibitor screening ( ).

  3. Bacterial Physiology: Elucidates the interplay between membrane lipid metabolism and oligosaccharide biosynthesis ( ).

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All protein shipments are standardly packed with blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend incorporating 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and inherent protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mdoB; opgB; ECH74115_5872; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-763
Protein Length
full length protein
Species
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Target Names
mdoB
Target Protein Sequence
MSELLSFALFLASVLIYAWKAGRNTWWFAATLTVLGLFVVLNITLFASDYFTGDGINDAV LYTLTNSLTGAGVSKYILPGIGIVLGLTAVFGALGWILRRRRHHPHHFGYSLLALLLALG SVDASPAFRQITELVKSQSRDGDPDFAAYYKEPSKTIPDPKLNLVYIYGESLERTYFDNE AFPDLTPELGALKNEGLDFSHTQQLPGTDYTIAGMVASQCGIPLFAPFEGNASASVSSFF PQNICLGDILKNSGYQNYFVQGANLRFAGKDVFLKSHGFDHLYGSEELKSVVADPHYRND WGFYDDTVLDEAWKKFEELSRSGQRFSLFTLTVDTHHPDGFISRTCNRKKYDFDGKPNQS FSAVSCSQENIATFINKIKASPWFKDTVIVVSSDHLAMNNTAWKYLNKQDRNNLFFVIRG DKPQQETLAVKRNTMDNGATVLDILGGDNYLGLGRSSLSGQSMSEIFLNIKEKTLAWKPD IIRLWKFPKEMKEFTIDQQKNMIAFSGSHFRLPLLLRVSDKRVEPLPESEYSAPLRFQLA DFAPRDNFVWVDRCYKMAQLWAPELALSTDWCVSQGQLGGQQIVQHVDKTTWKSKTAFKD TVIDMARYKGNVDTLKIVDNDIRYKADSFIFNVAGAPEEVKQFSGISRPESWGRWSNAQL GDEVKIEYKHPLPKKFDLVITAKAYGNNASRPIPVRVGNEEQTLVLGNEVTTTTLHFDNP TDADTLVIVPPEPVSTNEGNILGHSPRKLGIGMVEIKVVEREG
Uniprot No.

Target Background

Function
Transfers a phosphoglycerol residue from phosphatidylglycerol to the membrane-bound nascent glucan backbones.
Database Links
Protein Families
OpgB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Phosphoglycerol transferase I and what is its function in E. coli O157:H7?

Phosphoglycerol transferase I is an enzyme located in the inner cytoplasmic membrane of Escherichia coli that catalyzes the transfer of phosphoglycerol residues from phosphatidylglycerol to membrane-derived oligosaccharides (MDOs) or to model substrates such as arbutin (p-hydroxyphenyl-beta-D-glucoside). The products of this enzymatic reaction are phosphoglycerol diester derivatives of MDOs or arbutin, along with sn-1,2-diglyceride . This enzyme plays a crucial role in the modification of periplasmic glucans, which affects membrane properties and potentially influences the pathogenicity of E. coli O157:H7 strains. The active site of this enzyme is positioned on the outer aspect of the inner membrane, allowing it to transfer phosphoglycerol residues to substrates in the periplasmic space .

How does the mdoB gene in E. coli O157:H7 differ from non-pathogenic E. coli strains?

The mdoB gene in E. coli O157:H7 exists within a genomic context that differs significantly from non-pathogenic strains like E. coli K-12. While the enzyme's core function remains similar, the genomic environment of E. coli O157:H7 includes numerous horizontally transferred elements that may influence expression patterns and regulation. The pathogenic strain contains approximately 463 phage-associated genes compared to only 29 in E. coli K-12 . Additionally, genome comparison between E. coli O157:H7 and non-pathogenic E. coli K-12 reveals that 0.53 Mb of DNA present in K-12 is missing from O157:H7, suggesting that genomic reduction has played a role in the evolution of this pathogenic strain . These genomic differences may affect the expression and function of mdoB, potentially contributing to the pathogenic properties of E. coli O157:H7.

What phenotypic effects result from mdoB mutations in E. coli?

Mutations in the mdoB gene result in strains that lack detectable phosphoglycerol transferase I activity. These mutants cannot transfer phosphoglycerol residues to arbutin in vivo and synthesize membrane-derived oligosaccharides that are completely devoid of phosphoglycerol residues . Interestingly, in strains carrying a dgk mutation (which causes deficiency in diglyceride kinase), the presence of functional phosphoglycerol transferase I causes growth inhibition when arbutin is present in the medium. This occurs because these strains accumulate large amounts of sn-1,2-diglyceride, a product of the phosphoglycerol transferase I reaction . Additional mutations in such dgk strains that lead to loss of phosphoglycerol transferase I activity result in arbutin resistance, a phenotype that has been exploited for isolating mdoB mutants in laboratory settings.

What are the optimal experimental designs for studying recombinant Phosphoglycerol transferase I activity?

When studying recombinant Phosphoglycerol transferase I from E. coli O157:H7, implementing a robust design of experiments (DOE) approach is essential. DOE provides a systematic, efficient method to study relationships between multiple input variables (factors) and key output variables (responses) such as enzyme activity, stability, and substrate specificity . An effective experimental design should:

  • Determine which factors (e.g., pH, temperature, substrate concentration, cofactors) affect enzyme activity

  • Identify potential interactions between these factors

  • Model the response as a function of significant factors

  • Optimize enzyme activity or stability

Rather than using inefficient one-factor-at-a-time (OFAT) approaches, researchers should implement factorial designs that examine all factors simultaneously across the experimental region. This allows for understanding the combined effects of multiple variables and their interactions, which is critical for characterizing enzymatic behavior . A central composite design or Box-Behnken design would be particularly suitable for optimizing conditions for recombinant Phosphoglycerol transferase I expression and activity.

How can I establish a reliable assay system for measuring phosphoglycerol transferase activity?

A reliable assay system for measuring phosphoglycerol transferase I activity should include:

  • In vitro transfer assay: Measure the transfer of phosphoglycerol residues from phosphatidylglycerol to membrane-derived oligosaccharides or to the model substrate arbutin under controlled conditions . The formation of phosphoglycerol diester derivatives and sn-1,2-diglyceride can be quantified using chromatographic techniques.

  • In vivo complementation assay: Use E. coli strains bearing both dgk and mdoB mutations, which exhibit arbutin resistance. Complementation with a functional recombinant mdoB gene should restore arbutin sensitivity in these strains .

  • Controls and standards: Include wild-type E. coli phosphoglycerol transferase I as a positive control and heat-inactivated enzyme as a negative control. Use purified MDOs or arbutin of known concentrations to generate standard curves.

  • Validation measures: Implement replicate measurements and randomization of experimental runs to minimize systematic errors and bias, following DOE principles established by Ronald Fisher (randomization, replication, blocking, and factorial principle) .

Table 1: Recommended components for Phosphoglycerol transferase I activity assay

ComponentConcentration RangePurpose
Phosphatidylglycerol0.1-1.0 mMDonor substrate
Arbutin or MDOs1-10 mMAcceptor substrate
MgCl₂5-10 mMCofactor
Buffer (HEPES or Tris)50-100 mM, pH 7.0-8.0Maintain optimal pH
NaCl50-150 mMIonic strength
Purified enzyme0.1-1.0 μg/mlCatalyst

What expression systems are most suitable for producing functional recombinant Phosphoglycerol transferase I?

Selecting an appropriate expression system is critical for obtaining functional recombinant Phosphoglycerol transferase I from E. coli O157:H7. Consider the following options and considerations:

  • E. coli expression systems:

    • BL21(DE3) strains are suitable for cytoplasmic expression

    • C43(DE3) or C41(DE3) strains are preferred for membrane proteins

    • Codon-optimized constructs may be necessary due to potential rare codons in the O157:H7 mdoB gene

  • Expression vectors:

    • pET vectors with T7 promoter systems allow for controlled induction

    • Vectors containing fusion tags (His6, MBP, GST) facilitate purification

    • Consider vectors with periplasmic targeting sequences, as the enzyme naturally functions at the membrane interface

  • Induction conditions:

    • Lower temperatures (16-25°C) often improve folding of membrane-associated proteins

    • Use DOE methodology to optimize IPTG concentration, induction time, and temperature

  • Membrane preparation:

    • Since Phosphoglycerol transferase I is membrane-associated, proper membrane fraction isolation is essential

    • Consider using detergents for solubilization while maintaining enzyme function

The optimal expression system should be determined experimentally, as the properties of recombinant Phosphoglycerol transferase I from the pathogenic O157:H7 strain may differ from those of non-pathogenic strains.

How can computational approaches enhance our understanding of Phosphoglycerol transferase I structure and function?

Computational approaches offer powerful tools for investigating Phosphoglycerol transferase I structure-function relationships:

  • Homology modeling: In the absence of crystal structures, homology models can predict the three-dimensional structure of Phosphoglycerol transferase I based on related proteins. These models can identify potential catalytic residues and substrate binding sites.

  • Molecular dynamics simulations: These can reveal how the enzyme interacts with membrane components and substrates, providing insights into the mechanism of phosphoglycerol transfer.

  • Genomic context analysis: Comparing the genomic neighborhood of mdoB in E. coli O157:H7 with other strains can identify potential regulatory elements or functional partners. This is particularly relevant given that E. coli O157:H7 contains numerous horizontally transferred elements that distinguish it from non-pathogenic strains .

  • Evolutionary analysis: Examining sequence conservation across diverse bacterial species can identify critical functional domains. The unique genomic features of E. coli O157:H7, including its acquisition of foreign DNA through horizontal gene transfer, make evolutionary analyses particularly informative .

  • Virtual screening: Computational docking of potential inhibitors can guide the development of compounds that specifically target Phosphoglycerol transferase I in pathogenic strains.

These computational approaches complement experimental methods and can guide hypothesis generation for targeted laboratory investigations.

What is the relationship between Phosphoglycerol transferase I activity and biofilm formation in E. coli O157:H7?

The relationship between Phosphoglycerol transferase I activity and biofilm formation represents an important research direction with implications for pathogenicity. Membrane-derived oligosaccharides modified by Phosphoglycerol transferase I contribute to membrane properties that may influence bacterial adhesion and biofilm development. Research approaches to investigate this relationship should include:

  • Comparative biofilm assays: Compare biofilm formation between wild-type E. coli O157:H7 and isogenic mdoB mutants under various environmental conditions.

  • Complementation studies: Restore mdoB function in mutant strains to confirm phenotypic effects are specifically due to loss of Phosphoglycerol transferase I activity.

  • Microscopic analysis: Use confocal microscopy with fluorescent stains to examine biofilm architecture and extracellular matrix composition in wild-type and mutant strains.

  • Gene expression analysis: Investigate whether mdoB expression changes during different stages of biofilm development using quantitative RT-PCR or RNA-seq approaches.

  • Environmental stress responses: Determine how Phosphoglycerol transferase I activity affects biofilm resistance to antimicrobials, pH changes, or osmotic stress—conditions often encountered during infection.

The connection between membrane composition, modified by enzymes like Phosphoglycerol transferase I, and virulence factors such as biofilm formation represents an important frontier in understanding E. coli O157:H7 pathogenicity.

How do contradictory experimental results regarding mdoB function arise, and how should researchers address them?

Contradictory results in mdoB function studies may arise from several sources and should be addressed systematically:

  • Strain differences: E. coli O157:H7 strains exhibit genomic heterogeneity, with different isolates containing varying prophage elements and other mobile genetic elements . Researchers should fully characterize and document the specific strain used, including its source and passage history.

  • Experimental conditions: Phosphoglycerol transferase I activity may be sensitive to subtle differences in assay conditions, including membrane preparation methods, substrate sources, and reaction parameters. Detailed reporting of methodologies is essential for reproducibility.

  • Enzymatic assay limitations: In vitro assays may not fully recapitulate the native membrane environment. Consider complementary approaches:

    • In vivo phenotypic assays

    • Genetic complementation studies

    • Membrane composition analysis

  • Statistical considerations: Apply appropriate statistical methods to evaluate experimental data, as outlined in DOE principles . This includes:

    • Adequate replication

    • Randomization of experimental runs

    • Blocking to control for nuisance variables

    • Factorial designs to detect interactions

  • Resolution approaches: When facing contradictory results:

    • Perform independent validation with multiple methods

    • Collaborate with other laboratories to test reproducibility

    • Consider systematic reviews or meta-analyses of published data

    • Use research databases for comprehensive literature searches

Table 2: Common sources of variability in Phosphoglycerol transferase I experiments

Source of VariabilityPotential ImpactMitigation Strategy
Membrane preparation methodAltered enzyme activity/orientationStandardize isolation protocols
Growth conditionsChanges in membrane compositionControl temperature, media, growth phase
Substrate qualityInconsistent enzyme kineticsUse analytical-grade reagents, verify purity
Strain differencesVarying expression levels or enzyme variantsSequence verification, isogenic controls
Assay componentsInterference with activity measurementsInclude appropriate controls, optimize assay

What are the most effective strategies for purifying recombinant Phosphoglycerol transferase I while maintaining enzymatic activity?

Purifying membrane-associated enzymes like Phosphoglycerol transferase I presents unique challenges. The following strategies can optimize purification while preserving activity:

  • Membrane extraction optimization:

    • Try multiple detergents (DDM, CHAPS, Triton X-100) at various concentrations

    • Consider detergent-free methods using styrene-maleic acid copolymer (SMA) lipid particles

    • Test both harsh and gentle solubilization conditions, comparing activity retention

  • Affinity chromatography:

    • N-terminal or C-terminal His6-tags generally provide good yields

    • Consider MBP fusion for enhanced solubility and affinity purification

    • Include detergent in all buffers to maintain solubility

  • Activity preservation measures:

    • Add phospholipids or synthetic lipids to stabilize the enzyme

    • Include glycerol (10-20%) in all buffers

    • Maintain low temperature throughout purification

    • Test activity after each purification step to track recovery

  • Final formulation:

    • Determine optimal storage conditions (temperature, buffer composition)

    • Consider lyophilization with appropriate cryoprotectants

    • Test activity retention over time under various storage conditions

A DOE approach can efficiently optimize these multiple variables simultaneously rather than testing each factor independently .

How can researchers accurately determine the kinetic parameters of Phosphoglycerol transferase I?

Accurate determination of kinetic parameters for Phosphoglycerol transferase I requires careful experimental design and analysis:

  • Initial rate measurements:

    • Ensure measurements are made within the linear range of the reaction

    • Use substrate concentrations spanning at least 0.2× to 5× the expected Km

    • Maintain consistent enzyme concentration across experiments

  • Substrate considerations:

    • Both substrates (phosphatidylglycerol and MDOs/arbutin) must be varied systematically

    • Use high-purity substrates with verified concentrations

    • Consider potential substrate inhibition at high concentrations

  • Data analysis approaches:

    • For single-substrate analysis: use Lineweaver-Burk, Eadie-Hofstee, or non-linear regression

    • For bi-substrate kinetics: employ appropriate models (ping-pong, ordered sequential, random sequential)

    • Use specialized enzyme kinetics software for complex models

  • Validation of kinetic models:

    • Compare multiple kinetic models to determine best fit

    • Use statistical criteria (AIC, BIC) to select between competing models

    • Verify predictions with independent experiments

Table 3: Methodological approaches for kinetic parameter determination

ParameterMeasurement ApproachAnalytical MethodValidation Technique
KmVary substrate concentrationNon-linear regressionReplicate determinations
VmaxExtrapolate to infinite substrateDirect fit to Michaelis-MentenMultiple enzyme concentrations
kcatDetermine enzyme molarityVmax/[E] calculationActive site titration
Substrate specificityCompare different substratesRelative kcat/Km valuesStructure-activity relationships
Inhibition constantsVary inhibitor concentrationsDixon plotsMultiple inhibitor types

How does Phosphoglycerol transferase I activity contribute to E. coli O157:H7 virulence and host interactions?

The potential role of Phosphoglycerol transferase I in E. coli O157:H7 virulence represents an important research direction. Several experimental approaches can address this question:

  • Animal infection models: Compare colonization and virulence of wild-type and mdoB mutant strains in appropriate animal models. Measure parameters such as:

    • Intestinal adherence efficiency

    • Persistence in the gastrointestinal tract

    • Toxin production and delivery

    • Host inflammatory response

  • Cell culture systems: Investigate interactions with human epithelial cells:

    • Adherence assays with intestinal epithelial cell lines

    • Invasion efficiency measurements

    • Cytotoxicity determinations

    • Type III secretion system functionality

  • Stress resistance profiles: Determine whether mdoB mutations affect resistance to host-derived stresses:

    • Antimicrobial peptides

    • Bile salts

    • Acid stress

    • Oxidative damage

  • Genomic context analysis: Examine whether the genomic environment of mdoB in E. coli O157:H7 differs from non-pathogenic strains, particularly given the significant genomic differences between pathogenic and non-pathogenic E. coli strains .

  • Transcriptomic studies: Investigate whether mdoB expression changes during infection processes or in response to host-derived signals.

These approaches can provide insights into whether and how Phosphoglycerol transferase I contributes to the distinctive pathogenicity of E. coli O157:H7.

What are the implications of targeting Phosphoglycerol transferase I for potential therapeutic interventions against E. coli O157:H7?

Investigating Phosphoglycerol transferase I as a potential therapeutic target requires consideration of several key aspects:

  • Target validation studies:

    • Confirm whether mdoB deletion attenuates virulence in relevant models

    • Determine if chemical inhibition of the enzyme reduces pathogenicity

    • Assess potential for resistance development

  • Inhibitor development strategy:

    • Structure-based design if structural information is available

    • High-throughput screening against purified enzyme

    • Whole-cell screening with relevant phenotypic readouts

    • Fragment-based approaches to identify initial scaffolds

  • Selectivity considerations:

    • Compare enzyme properties between pathogenic and commensal strains

    • Assess effects on human gut microbiome members

    • Identify unique structural features of the E. coli O157:H7 enzyme

  • Delivery challenges:

    • Design inhibitors that can access the periplasmic space

    • Consider prodrug approaches to enhance bacterial penetration

    • Evaluate local delivery options for intestinal infections

  • Combination approaches:

    • Test synergy with conventional antibiotics

    • Explore multi-target strategies affecting membrane integrity

    • Consider antivirulence rather than antibacterial approaches

This research direction requires collaborative efforts between structural biologists, medicinal chemists, microbiologists, and clinicians to develop effective interventions with minimal side effects.

How might systems biology approaches enhance our understanding of mdoB function in E. coli O157:H7?

Systems biology offers powerful approaches to contextualize Phosphoglycerol transferase I function within the broader cellular network:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data from wild-type and mdoB mutant strains

    • Map changes onto known metabolic and signaling pathways

    • Identify compensatory responses to mdoB deletion

  • Network analysis:

    • Construct protein-protein interaction networks involving Phosphoglycerol transferase I

    • Identify functional modules affected by mdoB activity

    • Predict secondary effects of enzyme inhibition

  • Flux balance analysis:

    • Model how changes in membrane composition affect metabolic flux

    • Predict growth phenotypes under various conditions

    • Identify metabolic vulnerabilities in mdoB mutants

  • Comparative genomics:

    • Analyze mdoB conservation and variation across E. coli pathotypes

    • Identify co-evolved genes that may functionally interact with mdoB

    • Understand the evolutionary history of phosphoglycerol transferase in the context of E. coli O157:H7's extensive horizontal gene transfer history

  • Synthetic biology approaches:

    • Design minimal systems to reconstitute mdoB function

    • Create reporter strains to monitor enzyme activity in vivo

    • Develop tunable expression systems to titrate enzyme levels

These approaches can provide a more comprehensive understanding of how Phosphoglycerol transferase I functions within the complex cellular environment of E. coli O157:H7.

What emerging technologies might advance research on recombinant Phosphoglycerol transferase I?

Several cutting-edge technologies hold promise for advancing research on recombinant Phosphoglycerol transferase I:

  • Cryo-electron microscopy:

    • Determine high-resolution structures of the enzyme in native-like lipid environments

    • Visualize enzyme-substrate complexes during catalysis

    • Capture conformational changes associated with activity

  • Single-molecule enzymology:

    • Observe individual enzyme molecules during catalytic cycles

    • Detect conformational dynamics during substrate binding and product release

    • Identify rate-limiting steps in the reaction mechanism

  • Nanodiscs and lipid cubic phase systems:

    • Reconstitute purified enzyme in defined membrane environments

    • Study the effects of lipid composition on enzyme activity

    • Create stable preparations for structural studies

  • CRISPR-based approaches:

    • Generate precise chromosomal modifications to study enzyme function

    • Create conditional expression systems for essential genes

    • Implement CRISPRi for tunable gene repression

  • Microfluidics and high-throughput screening:

    • Rapidly test multiple reaction conditions

    • Screen large libraries for enzyme variants or inhibitors

    • Analyze single-cell phenotypes in heterogeneous populations

These technological advances can address current limitations in studying membrane-associated enzymes and provide unprecedented insights into Phosphoglycerol transferase I structure, function, and regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.