Recombinant Escherichia coli O157:H7 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli O157:H7 ArnE

The recombinant Escherichia coli O157:H7 ArnE protein is a subunit of an undecaprenyl phosphate-aminoarabinose flippase system critical for bacterial membrane biogenesis and pathogenicity. This enzyme facilitates the translocation of lipid intermediates across the inner membrane, enabling the modification of lipopolysaccharide (LPS) lipid A with 4-amino-4-deoxy-L-arabinose (L-Ara4N). This modification enhances resistance to host-derived antimicrobial peptides, a key virulence factor in pathogenic E. coli strains .

Amino Acid Sequence and Domains

ArnE belongs to the EamA-like transporter family and contains a conserved EamA domain critical for substrate binding and transport. While the exact sequence of E. coli O157:H7 ArnE is not explicitly provided in publicly available sources, homologs (e.g., Pseudomonas aeruginosa, Shigella sonnei) share structural motifs, including hydrophobic transmembrane helices and cytosolic domains .

Key Domains of ArnE

DomainFunctionSource Organism Example
EamA domainSubstrate recognition and transportPseudomonas aeruginosa
Transmembrane helicesMembrane anchoring and substrate channelShigella sonnei

Heterodimeric Structure with ArnF

ArnE forms a heterodimer with ArnF (formerly PmrM), functioning as a P4 ATPase flippase. This complex translocates α-L-Ara4N-phosphoundecaprenol from the cytoplasm to the periplasm, enabling L-Ara4N incorporation into lipid A . Structural studies of analogous P4 ATPases (e.g., Drs2, Dnf1) suggest conserved mechanisms, including ATP-dependent conformational changes to facilitate lipid flipping .

Production and Purification

Recombinant ArnE is typically expressed in E. coli with an N-terminal His-tag for affinity purification. Key production parameters include:

ParameterSpecificationSource
Expression HostE. coli
TagN-terminal His-tag
Protein LengthFull-length (1–114 aa)
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based, 6% trehalose, pH 8.0

Lyophilized protein is stored at −20°C/−80°C, with reconstitution in sterile water recommended for experimental use .

Lipid A Modification and Antimicrobial Resistance

ArnE’s flippase activity is integral to L-Ara4N lipid A modification, which:

  • Reduces electrostatic interactions between lipid A and cationic antimicrobial peptides (e.g., polymyxins) .

  • Enhances bacterial survival in host environments (e.g., phagosomes, epithelial surfaces) .

Regulation and Pathogenicity

ArnE expression is often upregulated under conditions mimicking host environments, such as low pH or antimicrobial stress. Strains lacking ArnE exhibit impaired L-Ara4N lipid A modification and reduced virulence .

Substrate Specificity and Transport Mechanism

ArnE-ArnF selectively translocates α-L-Ara4N-phosphoundecaprenol, distinguishing it from other lipid flippases. Structural studies of P4 ATPases suggest a “rocking” mechanism, where ATP hydrolysis drives substrate movement across the membrane .

Impact on Host-Pathogen Interactions

In E. coli O157:H7, L-Ara4N-modified LPS reduces recognition by host Toll-like receptor 4 (TLR4), dampening inflammatory responses and promoting colonization .

Experimental Tools

Recombinant ArnE is used to study:

  • LPS biosynthesis: In vitro assays to reconstitute lipid A modification .

  • Antimicrobial resistance: Screening inhibitors targeting ArnE-ArnF activity .

Therapeutic Targets

Disrupting ArnE-ArnF activity could restore bacterial susceptibility to antimicrobial peptides, offering a novel therapeutic strategy against antibiotic-resistant E. coli strains .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your preparations.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and inherent protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
arnE; ECH74115_3399; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Target Names
arnE
Target Protein Sequence
MIWLTLVFASLLSVAGQLCQKQATCFVAISKRRKHIVLWLGLALACLGLAMVLWLLVLQN VPVGIAYPMLSLNFVWVTLAAVKLWHEPVSPRHWCGVAFIIGGIVILGSTV
Uniprot No.

Target Background

Function
This protein functions as a flippase, translocating 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) across the inner membrane of *Escherichia coli* O157:H7, from the cytoplasm to the periplasm.
Database Links
Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of ArnE in E. coli O157:H7?

ArnE functions as an integral membrane component of the ArnE/ArnF undecaprenyl-phosphate-α-L-Ara4N flippase complex. This complex is responsible for transporting undecaprenyl-phosphate-α-L-Ara4N from the cytoplasmic face of the inner membrane to the periplasmic face of the inner membrane . The protein is localized to the inner membrane and has a predicted molecular weight of approximately 12.192 kD based on its nucleotide sequence .

ArnE belongs to the drug/metabolite transporter (DMT) superfamily and is predicted to contain four transmembrane helices . The functional complex may operate as a heterodimer with ArnF, with both proteins exhibiting similar structural characteristics within the membrane environment. This transport function is crucial for lipopolysaccharide modification pathways that contribute to antimicrobial resistance.

What is the structural information available for ArnE protein?

The structure of ArnE has been computationally modeled as evident in the AlphaFold Database (AF-A7ZP76-F1), released initially in December 2021 and last modified in September 2022 . The computed model demonstrates a relatively high confidence level with a global pLDDT (predicted Local Distance Difference Test) score of 88.62 , indicating good reliability of the predicted structure.

The model provides a visualization of the four predicted transmembrane helices that characterize this protein. It's important to note that this structure is computationally predicted rather than experimentally determined through methods such as X-ray crystallography or cryo-electron microscopy. Researchers should consider this limitation when designing structure-based experiments.

How does ArnE contribute to antimicrobial resistance in E. coli O157:H7?

ArnE plays a significant role in antimicrobial resistance, particularly against cationic antimicrobial peptides like polymyxin. Genetic studies have demonstrated that deletion of either arnE or arnF results in the restoration of polymyxin sensitivity in previously resistant strains carrying the pmrA constitutive mutation .

The ArnE/ArnF flippase complex facilitates the transport of 4-amino-4-deoxy-L-arabinose (L-Ara4N) to the outer leaflet of the inner membrane, where it can be incorporated into lipid A. This modification alters the negative charge of the bacterial outer membrane, reducing the electrostatic attraction of cationic antimicrobial peptides to the cell surface. The modified lipopolysaccharide structure thereby provides a mechanism of resistance against these antimicrobial agents, which are often last-resort antibiotics in clinical settings.

What are the optimal expression systems for recombinant ArnE production?

For expressing recombinant ArnE protein, the T7 promoter system in pET vectors is highly recommended due to its robust expression capabilities. When optimized, this system can yield target protein representing up to 50% of the total cell protein . The pET vectors contain the pMB1 origin of replication (medium copy number) and place the gene of interest under the control of a T7 promoter recognized by the T7 RNA polymerase .

To achieve controlled expression and minimize toxicity associated with membrane protein overexpression, researchers should consider using strains containing the λDE3 lysogen, which carries the T7 RNA polymerase gene under the control of the lacUV5 promoter. Additional control features such as T7 lysozyme expression (pLysS or pLysE plasmids) can further suppress basal expression, which is particularly important for potentially toxic membrane proteins like ArnE .

For dual expression systems (e.g., co-expressing ArnE and ArnF), vectors with different origins of replication should be used. A combination of pET (pMB1 origin) and pACYC or pBAD (p15A origin) vectors would allow stable maintenance of both plasmids in the same cell .

How can the N-terminal sequence of recombinant ArnE be optimized to increase expression yield?

Recent research demonstrates that modifying the N-terminal sequences of recombinant proteins can significantly increase production yields in E. coli. The nucleotides immediately following the start codon can substantially influence protein expression through impacts on translation initiation efficiency .

For optimizing ArnE expression, a directed evolution-based methodology is more effective than selecting from rationally designed sequences. This approach involves:

  • Creating DNA libraries with diversified sequences coding for the N-termini of ArnE

  • Fusing a GFP reporter gene to the C-terminus of ArnE for expression monitoring

  • Using fluorescence-activated cell sorting (FACS) to isolate cells with enhanced expression

  • Sequencing and characterizing the optimized N-terminal variants

This systematic workflow has been shown to elevate soluble recombinant protein yields by up to 30-fold in some constructs . The approach is particularly valuable for membrane proteins like ArnE, which often pose expression challenges due to their hydrophobic nature and potential toxicity.

What purification strategies are most effective for recombinant ArnE protein?

Purifying membrane proteins like ArnE presents unique challenges compared to soluble proteins. The following purification strategy is recommended:

Table 1: Optimized Purification Strategy for Recombinant ArnE

StageMethodKey ParametersConsiderations
Cell LysisFrench Press or SonicationBuffer: 50 mM Tris-HCl pH 7.5, 150 mM NaClInclude protease inhibitors to prevent degradation
Membrane IsolationUltracentrifugation100,000 × g, 1 hour, 4°CSeparate inner and outer membranes if needed
SolubilizationDetergent extraction1% n-dodecyl-β-D-maltoside (DDM), 2 hours, 4°CScreen multiple detergents for optimal solubilization
Affinity PurificationNickel-NTA (for His-tagged protein)Imidazole gradient: 20-300 mMUse mild detergent in all buffers (0.05% DDM)
Size ExclusionSuperdex 200Flow rate: 0.5 mL/minAssess oligomeric state (potential ArnE/ArnF complex)

When designing a purification strategy, it's essential to include an affinity tag that minimally impacts protein function. For membrane proteins like ArnE, a C-terminal tag is often preferable to avoid interfering with membrane insertion during translation. Additionally, the purification should maintain conditions that preserve protein-protein interactions if studying the ArnE/ArnF complex.

What methods can be used to evaluate ArnE-mediated flippase activity in vitro?

Evaluating the flippase activity of ArnE requires specialized assays to monitor the translocation of undecaprenyl-phosphate-α-L-Ara4N across membranes. The following methodologies are recommended:

Reconstituted Proteoliposome Assays:

  • Purify recombinant ArnE (and ArnF) using the strategy outlined in section 2.3

  • Reconstitute the purified protein(s) into liposomes composed of E. coli lipid extracts

  • Load fluorescently labeled substrate analogs inside the proteoliposomes

  • Monitor substrate translocation using fluorescence quenching techniques

Inverted Membrane Vesicle Assays:

  • Isolate inverted membrane vesicles from E. coli expressing recombinant ArnE

  • Add radioactively labeled undecaprenyl-phosphate-α-L-Ara4N substrate to the vesicle suspension

  • Separate vesicles from the reaction mixture using rapid filtration

  • Quantify transported substrate using scintillation counting

These functional analyses should include appropriate controls, such as ArnE mutants with disrupted transmembrane domains or ATP-depleted conditions, to confirm specificity of the transport activity.

How can protein-protein interactions between ArnE and ArnF be characterized?

Understanding the interaction between ArnE and ArnF is crucial for elucidating the functional mechanism of the flippase complex. Several complementary approaches can be employed:

In vivo approaches:

  • Bacterial two-hybrid assays using split reporter proteins

  • FRET (Förster Resonance Energy Transfer) with fluorescently tagged ArnE and ArnF

In vitro approaches:

  • Co-immunoprecipitation using tagged versions of ArnE and ArnF

  • Surface plasmon resonance to measure binding kinetics

  • Chemical cross-linking followed by mass spectrometry to identify interaction interfaces

Structural approaches:

  • Cryo-electron microscopy of the purified complex

  • Site-directed spin labeling coupled with electron paramagnetic resonance

When designing these experiments, researchers should consider the membrane environment's importance for proper folding and interaction of these proteins. Detergent micelles may not fully recapitulate the native membrane environment, potentially affecting interaction dynamics.

What genetic approaches can validate ArnE function in antimicrobial resistance?

To validate ArnE's role in antimicrobial resistance, several genetic approaches can be implemented:

Gene Deletion Studies:

  • Generate clean deletions of arnE using lambda Red recombineering

  • Complement deletions with plasmid-expressed wild-type or mutant arnE

  • Assess polymyxin sensitivity using minimum inhibitory concentration (MIC) assays

  • Compare lipid A modifications using mass spectrometry between wild-type and deletion strains

Site-Directed Mutagenesis:

  • Target conserved residues in predicted transmembrane domains

  • Create an alanine-scanning mutagenesis library

  • Assess each mutant for polymyxin resistance and lipid A modification

Reporter Fusion Assays:

  • Create transcriptional fusions of arnE promoter with reporter genes (e.g., lacZ, gfp)

  • Monitor expression under various conditions (pH, magnesium limitation, antimicrobial peptide exposure)

  • Identify regulatory factors controlling arnE expression

These genetic approaches should be conducted in appropriate E. coli O157:H7 strains to ensure relevance to the pathogenic context. Complementation studies are particularly important to confirm that phenotypic changes are specifically due to arnE manipulation rather than polar effects on adjacent genes.

How does the ArnE/ArnF flippase complex interact with other components of the LPS modification pathway?

The ArnE/ArnF flippase complex functions within a broader lipopolysaccharide modification pathway. Understanding its interactions with other pathway components requires sophisticated experimental approaches:

  • Protein-Protein Interaction Network Analysis:

    • Perform tandem affinity purification with tagged ArnE to identify interacting partners

    • Use quantitative proteomics to compare interactomes under different conditions

    • Validate interactions with binary methods (FRET, co-immunoprecipitation)

  • Metabolic Flux Analysis:

    • Trace the flow of radiolabeled arabinose through the pathway

    • Compare flux rates in wild-type versus arnE/arnF mutants

    • Identify rate-limiting steps in the pathway

  • Spatial Organization Studies:

    • Employ super-resolution microscopy to visualize co-localization of pathway components

    • Use fluorescence recovery after photobleaching (FRAP) to assess dynamics

    • Investigate potential lipid raft associations using detergent-resistant membrane fractions

The complex likely functions within a multiprotein assembly that coordinates substrate synthesis, transport, and final incorporation into lipid A. Elucidating these interactions will provide insights into potential vulnerability points for therapeutic intervention.

What are the structural determinants of substrate specificity in the ArnE flippase?

Understanding substrate specificity determinants requires detailed structure-function analyses:

  • Homology Comparison:

    • Align ArnE sequences across bacterial species

    • Identify conserved residues, particularly in transmembrane regions

    • Compare with related flippases having different substrate specificities

  • Computational Docking:

    • Use the available AlphaFold model (pLDDT: 88.62) for molecular docking simulations

    • Identify potential substrate binding pockets

    • Predict key residues involved in substrate recognition

  • Experimental Validation:

    • Generate point mutations at predicted substrate-interacting residues

    • Assess impacts on transport activity and substrate binding

    • Perform accessibility studies using cysteine scanning mutagenesis coupled with thiol-reactive probes

A proposed model for the substrate binding site based on computational analyses suggests the presence of a positively charged pocket formed between transmembrane helices 2 and 3, which may interact with the phosphate group of undecaprenyl-phosphate-α-L-Ara4N.

How can biophysical techniques be applied to understand the mechanism of substrate flipping?

Advanced biophysical techniques can elucidate the mechanistic details of substrate flipping:

Table 2: Biophysical Approaches for Studying ArnE-Mediated Flipping

TechniqueInformation ProvidedTechnical Considerations
Single-molecule FRETConformational changes during transport cycleRequires specific labeling of purified protein
Solid-state NMRStructural changes in membrane environmentRequires isotope-labeled protein in native-like lipid bilayers
Atomic Force MicroscopyTopography and mechanical propertiesCan visualize proteins in membrane at near-atomic resolution
Stopped-flow SpectroscopyKinetics of transport eventsRequires development of fluorescent substrate analogs
Molecular Dynamics SimulationsAtomistic details of flipping mechanismComputationally intensive; requires validation

These techniques should be applied in complementary fashion to build a comprehensive model of the flipping mechanism. For instance, combining structural data from solid-state NMR with dynamic information from single-molecule FRET and computational simulations can provide insights impossible to obtain from any single method alone.

What methods are most sensitive for detecting ArnE expression in clinical isolates?

Detection of ArnE expression in clinical isolates requires sensitive and specific methods:

  • Quantitative Real-Time PCR (qRT-PCR):

    • Design primers specific to arnE coding sequence

    • Validate specificity against closely related enterobacterial species

    • Use appropriate reference genes for normalization (e.g., 16S rRNA, rpoD)

  • Western Blotting:

    • Generate specific antibodies against ArnE peptides

    • Include appropriate positive controls (recombinant ArnE) and negative controls (arnE deletion strains)

    • Use membrane fraction enrichment to improve detection sensitivity

  • Mass Spectrometry-Based Proteomics:

    • Perform targeted selected reaction monitoring (SRM) assays

    • Develop specific peptide signatures for ArnE detection

    • Quantify expression levels relative to standard curves

When analyzing clinical isolates, researchers should consider that expression levels may vary based on growth conditions. Standardized culture conditions that mimic relevant host environments (e.g., low pH, limited magnesium) may be necessary to detect physiologically relevant expression patterns.

How can ArnE be incorporated into rapid detection systems for E. coli O157:H7?

Building on established detection methods for E. coli O157:H7, ArnE can be incorporated into rapid detection systems:

  • Recombinase Polymerase Amplification (RPA) Coupled with Lateral Flow Assay:

    • Design specific primers and probes targeting the arnE gene

    • Optimize RPA conditions (39°C for 20 minutes) for efficient amplification

    • Develop a lateral flow detection format for point-of-care applications

  • CRISPR-Cas-Based Detection:

    • Design guide RNAs specific to arnE sequences

    • Couple with colorimetric or fluorescence-based reporters

    • Develop smartphone-based readout systems for field applications

  • Aptamer-Based Biosensors:

    • Select aptamers with high affinity for ArnE protein

    • Incorporate into electrochemical or optical sensing platforms

    • Optimize for direct detection in food or environmental samples

These detection systems should be validated for sensitivity and specificity using a panel of E. coli O157:H7 strains and closely related non-pathogenic E. coli isolates. The RPA-LFA approach has demonstrated effectiveness for detecting E. coli O157:H7 using other target genes, with amplification at 39°C for 20 minutes providing rapid results .

What cell-based assays can evaluate ArnE inhibitors for antimicrobial development?

Developing cell-based assays to identify potential ArnE inhibitors represents an important approach for novel antimicrobial discovery:

Table 3: Cell-Based Assays for ArnE Inhibitor Screening

Assay TypePrincipleReadoutAdvantages
Polymyxin SensitizationInhibited ArnE increases polymyxin sensitivityGrowth inhibitionPhysiologically relevant
Reporter-BasedArnE function coupled to reporter gene expressionFluorescence/luminescenceHigh-throughput compatible
Lipid A ModificationDirect assessment of L-Ara4N incorporationMass spectrometryDirectly measures biochemical outcome
Membrane PermeabilityCompromised LPS modification increases permeabilityFluorescent dye uptakeRapid assessment

When designing inhibitor screens, researchers should include appropriate controls to distinguish between specific ArnE inhibition and non-specific effects on bacterial growth or membrane integrity. Structure-based virtual screening utilizing the ArnE computational model (pLDDT: 88.62) can complement cell-based assays to identify promising chemical scaffolds for further development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.