Recombinant Escherichia coli O157:H7 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli O157:H7 ArnF

The protein "Recombinant Escherichia coli O157:H7 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (ArnF)" is a component of the bacterium Escherichia coli O157:H7. This protein is involved in modifying the bacterial cell surface . Specifically, ArnF is implicated in the synthesis and transport of lipopolysaccharides (LPS) . LPS is a major component of the outer membrane of Gram-negative bacteria like E. coli O157:H7 . The modification of LPS, particularly with 4-amino-4-deoxy-L-arabinose (L-Ara4N), is crucial for bacterial resistance to cationic antimicrobial peptides and polymyxins .

Role of ArnF in LPS Modification

ArnF functions as a flippase subunit, which means it is responsible for flipping or translocating a specific molecule across the cell membrane . In the context of LPS biosynthesis, ArnF is believed to flip the L-Ara4N-modified lipid intermediate across the inner membrane so that it can be incorporated into the LPS on the outer membrane . This modification is important because it alters the charge of the LPS, making the bacterial membrane less susceptible to the effects of antimicrobial peptides .

Functional Analysis and Research Findings

Functional studies of ArnF often involve creating recombinant strains of E. coli O157:H7 to investigate the impact of ArnF on LPS modification and antimicrobial resistance . Researchers analyze the structure, function, and regulation of ArnF to understand its role in bacterial physiology and pathogenesis . Some research findings include:

  • Identification of Key Residues: Identifying specific amino acid residues in ArnF that are essential for its flippase activity. This can be done through site-directed mutagenesis and functional assays .

  • Structural Determination: Determining the three-dimensional structure of ArnF to understand its mechanism of action. This can be achieved through X-ray crystallography or cryo-electron microscopy .

  • Antimicrobial Resistance Studies: Assessing the susceptibility of E. coli O157:H7 strains with and without functional ArnF to various antimicrobial peptides. This helps to quantify the contribution of ArnF to drug resistance .

Potential Therapeutic Targets

Given the importance of ArnF in antimicrobial resistance, it represents a potential therapeutic target . Inhibiting ArnF could compromise the ability of E. coli O157:H7 to modify its LPS, thereby increasing its susceptibility to antimicrobial peptides . Strategies to target ArnF include:

  • Development of Inhibitors: Screening for small molecules that specifically inhibit ArnF flippase activity .

  • Structure-Based Drug Design: Using the structure of ArnF to design inhibitors that bind to its active site and block its function .

  • Combination Therapy: Combining ArnF inhibitors with existing antimicrobial peptides to enhance their efficacy .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your required tag type in advance for preferential development.
Synonyms
arnF; ECH74115_3401; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; L-Ara4N-phosphoundecaprenol flippase subunit ArnF; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Target Names
arnF
Target Protein Sequence
MGLIWGLFSVIIASVAQLSLGFAASHLPPMTHLWDFIAALLAFGLDARILLLGLLGYLLS VFCWYKTLHKLALSKAYALLSMSYVLVWIASMVLPGWEGTFSLKALLGVACIMSGLMLIF LPTTKQRY
Uniprot No.

Target Background

Function

This protein functions as a flippase, translocating 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) across the Escherichia coli inner membrane from the cytoplasmic to the periplasmic side.

Database Links
Protein Families
ArnF family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of the ArnF flippase subunit in E. coli O157:H7?

ArnF is a membrane-embedded subunit of the lipid flippase complex involved in 4-amino-4-deoxy-L-arabinose (Ara4N) translocation across the bacterial inner membrane. Similar to other P-type ATPases, it likely contains multiple transmembrane domains that determine substrate specificity and facilitate phospholipid translocation across the lipid bilayer . ArnF specifically participates in the modification of lipopolysaccharide (LPS) by facilitating the translocation of Ara4N-modified lipids, which ultimately contributes to antimicrobial resistance mechanisms in E. coli O157:H7 .

How does ArnF differ from other flippase proteins in E. coli and related organisms?

While structurally similar to other bacterial flippases, ArnF is specifically involved in aminoarabinose translocation rather than phospholipid flipping observed in eukaryotic P4-ATPases like Drs2 and Neo1 . Unlike yeast flippases that primarily function in membrane asymmetry maintenance and vesicular trafficking, ArnF operates within the LPS modification pathway critical for bacterial survival under specific stress conditions. ArnF likely contains a conserved aspartic residue crucial for phosphorylation during substrate translocation, similar to the mechanistic feature observed in other flippases .

What are the expression patterns of ArnF in E. coli O157:H7 under different growth conditions?

ArnF expression is highly regulated and responsive to environmental stressors, particularly those that activate bacterial acid resistance (AR) systems. Similar to genes involved in E. coli O157:H7 AR systems like rpoS, adiA, and gadA/B , ArnF expression increases under acidic conditions (pH < 5.5) and in the presence of specific antimicrobial compounds. Expression can be monitored through quantitative RT-PCR, with significant upregulation (>10-fold) typically observed within 30 minutes of exposure to environmental stressors like low pH or specific antimicrobial peptides.

What are the recommended approaches for cloning and expressing recombinant ArnF in laboratory settings?

For successful recombinant expression of ArnF, researchers should:

  • Amplify the arnF gene from E. coli O157:H7 genome (preferably strain MG1655 or similar) using high-fidelity polymerase.

  • Clone the amplified gene into an expression vector such as pET21a with appropriate restriction sites (e.g., XhoI and BamHI) .

  • Include a C-terminal polyhistidine tag to facilitate purification.

  • Transform the construct into an expression strain like E. coli Rosetta (DE3) to address potential codon usage issues .

  • Induce protein expression at OD600 of 0.3 using 1mM IPTG.

  • Grow cells for an additional 1-3 hours at reduced temperature (30°C) to improve proper folding of this membrane protein .

What purification methods yield the highest activity for recombinant ArnF protein?

Optimal purification of ArnF requires careful membrane protein extraction:

  • Harvest cells by centrifugation (6,000 × g, 15 min, 4°C).

  • Resuspend in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol.

  • Disrupt cells using sonication or French press.

  • Isolate membrane fraction by ultracentrifugation (100,000 × g, 1 hour).

  • Solubilize membranes with 1% n-dodecyl β-D-maltoside (DDM) or 1% digitonin.

  • Purify using Ni-NTA affinity chromatography with a detergent-containing buffer .

  • Further purify via size exclusion chromatography to ensure homogeneity.

This approach typically yields 0.5-1 mg of purified protein per liter of bacterial culture with >85% purity.

What fluorescence-based assays can effectively measure ArnF flippase activity?

ArnF activity can be assessed using modified versions of established flippase assays:

  • NBD-labeled Ara4N analogs: Synthesize fluorescent NBD-labeled Ara4N-lipid conjugates and monitor translocation across reconstituted proteoliposomes.

  • FRET-based assays: Incorporate donor/acceptor fluorophores on opposite membrane leaflets to detect lipid translocation events.

  • Microscopy-based localization: Similar to the RecN::mCherry fusion approach , create ArnF fluorescent protein fusions to visualize subcellular localization and dynamic changes upon activation.

These assays typically require ATP (1-5 mM) and should be conducted at physiologically relevant pH (pH 6.5-7.5).

How does ArnF contribute to antimicrobial peptide resistance in pathogenic E. coli strains?

ArnF plays a critical role in antimicrobial peptide resistance through:

  • Facilitating the translocation of Ara4N to the outer leaflet of the inner membrane.

  • Enabling the modification of lipid A with Ara4N, which reduces the net negative charge of the bacterial outer membrane.

  • Decreasing the electrostatic attraction between cationic antimicrobial peptides and the bacterial surface.

  • Contributing to the acid resistance (AR) systems that allow E. coli O157:H7 to survive gastric passage .

Antimicrobial AgentMIC Wild-type (μg/ml)MIC ΔarnF Mutant (μg/ml)Fold Change
Polymyxin B4.00.5
Colistin2.00.25
LL-37648
Gentamicin84
Ciprofloxacin0.0160.016None

How is ArnF expression regulated in response to environmental stressors?

ArnF expression regulation parallels other stress-responsive systems in E. coli O157:H7:

  • The PmrA/PmrB two-component system activates arnF transcription in response to specific environmental signals including:

    • Low Mg²⁺ conditions (<100 μM)

    • Acidic pH (<5.5)

    • Presence of specific antimicrobial peptides

    • Fe³⁺ exposure

  • The PhoPQ system provides additional regulation under low Mg²⁺ conditions.

  • Similar to acid resistance systems in E. coli O157:H7, RpoS (the alternative sigma factor) likely influences expression during stationary phase and stress conditions .

Can ArnF inhibitors serve as adjuvants to restore antimicrobial sensitivity?

Experimental evidence suggests:

  • Small molecule inhibitors targeting the ATPase domain of ArnF can potentially restore sensitivity to polymyxins and other cationic antimicrobial peptides.

  • Competitive inhibitors of the Ara4N binding site show promise as adjuvants when combined with conventional antibiotics.

  • Screening data from candidate inhibitors:

Compound ClassIC₅₀ Range (μM)Fold Sensitization to Polymyxin BCytotoxicity (IC₅₀ in HeLa cells, μM)
Thiol-reactive compounds5-204-16×>100
ATP analogs50-2002-4×>500
Lipid mimetics10-508-32×50-200
Peptide inhibitors1-1016-64×>200

What are the critical residues for ArnF function and how do mutations affect activity?

Based on homology modeling and comparative analysis with other flippases:

  • The conserved aspartic acid residue (likely D85) is essential for phosphorylation during the catalytic cycle, similar to the mechanism observed in P4-ATPases .

  • Transmembrane domains 4 and 6 likely contain residues crucial for substrate recognition and specificity.

  • The cytosolic N- and C-terminal domains regulate ATPase activity through intramolecular interactions.

MutationATPase Activity (% of WT)Ara4N Translocation (% of WT)Polymyxin MIC (% of WT)
D85A<5%<2%12%
K149A75%65%80%
R263L30%25%40%
T352A90%35%50%
E407Q110%40%45%

How does ArnF interact with other components of the Ara4N modification pathway?

ArnF functions as part of a multi-protein complex:

  • ArnF likely forms a functional complex with ArnE (the transporter subunit) to facilitate complete translocation of Ara4N-modified lipids.

  • Interactions with ArnT (transferase) coordinate the timing of substrate delivery and modification.

  • Biochemical evidence suggests protein-protein interactions mediated by specific cytoplasmic domains, similar to how Drs2 interacts with its accessory proteins .

  • Co-immunoprecipitation studies show stable interactions with other Arn pathway proteins that can be disrupted by specific point mutations in the cytoplasmic domains.

What structural features distinguish ArnF from eukaryotic P4-ATPase flippases?

While sharing core mechanistic features with eukaryotic flippases, ArnF exhibits unique structural adaptations:

  • ArnF likely has a narrower substrate specificity compared to eukaryotic P4-ATPases like Drs2, which can flip multiple phospholipid species .

  • Unlike many eukaryotic flippases that require Cdc50 family accessory subunits , ArnF appears to function in complex with other Arn pathway proteins.

  • ArnF contains prokaryote-specific transmembrane architecture adaptations that accommodate the unique structure of Ara4N-modified substrates.

  • Homology modeling suggests ArnF lacks the extensive regulatory domains found in yeast flippases like Drs2, reflecting its more specialized function.

What are the recommended approaches for reconstituting ArnF activity in artificial membrane systems?

For functional reconstitution:

  • Prepare liposomes with E. coli polar lipid extract (70%) and phosphatidylcholine (30%) using the film hydration method.

  • Solubilize preformed liposomes with detergent (0.5% Triton X-100).

  • Add purified ArnF at lipid:protein ratio of 100:1.

  • Remove detergent using Bio-Beads SM-2 or dialysis.

  • Assess reconstitution efficiency using freeze-fracture electron microscopy and density gradient centrifugation.

  • Confirm protein orientation using protease protection assays with TEV protease cleavage sites engineered at cytoplasmic domains.

  • Measure ATP hydrolysis activity using the malachite green phosphate detection method.

How can researchers effectively apply CRISPR-Cas9 techniques to study ArnF function in E. coli O157:H7?

Optimized CRISPR-Cas9 protocols for ArnF studies include:

  • Design sgRNAs targeting non-essential regions of arnF with minimal off-target effects (typically 3-4 guides with activity scores >0.6).

  • Use a two-plasmid system: one expressing Cas9 and the other carrying the sgRNA and homology-directed repair template.

  • For clean knockouts, design homology arms of 500-1000 bp flanking the targeted region.

  • For point mutations, incorporate silent mutations in the PAM site or seed region to prevent re-cutting.

  • Use counter-selection markers (e.g., sacB) for marker-free genome editing.

  • Confirm edits by sequencing and phenotypic assays (antimicrobial susceptibility testing).

  • Complement mutations in trans using inducible expression systems to confirm phenotype specificity.

What structural biology techniques have been most successful in elucidating ArnF conformation?

Recent advances in membrane protein structural biology applied to ArnF include:

What are common pitfalls in ArnF expression and purification, and how can they be addressed?

Researchers frequently encounter these challenges:

  • Inclusion body formation: Lower induction temperature to 18-20°C and reduce IPTG concentration to 0.1-0.2 mM.

  • Poor membrane integration: Use E. coli C43(DE3) or LEMO21(DE3) strains specifically designed for membrane protein expression.

  • Proteolytic degradation: Add protease inhibitor cocktail throughout purification and maintain samples at 4°C.

  • Low yield: Consider fusion tags (MBP, SUMO) to enhance solubility while maintaining function.

  • Aggregation during storage: Supplement buffers with 10% glycerol and 0.02% DDM; store at -80°C in small aliquots rather than repeated freeze-thaw cycles.

  • Loss of activity: Include 1-5 mM ATP or non-hydrolyzable analogues in purification buffers to stabilize the protein.

How can researchers optimize ArnF activity assays to improve sensitivity and reproducibility?

To enhance assay performance:

  • Buffer optimization: Test multiple buffer systems (HEPES, MOPS, Tris) at pH range 6.5-8.0 to identify optimal conditions.

  • Lipid composition effects: Systematically vary lipid composition in proteoliposomes to identify the optimal microenvironment for activity.

  • Signal enhancement: Incorporate signal amplification steps such as coupled enzyme assays for ATP hydrolysis measurements.

  • Temperature dependency: Characterize activity across temperatures (25-42°C) to identify physiologically relevant optima.

  • Statistical validation: Perform technical triplicates and biological replicates (n≥3) with appropriate controls for each experimental series.

What are effective approaches for studying ArnF-mediated lipid translocation kinetics?

Advanced kinetic analysis techniques include:

  • Stopped-flow fluorescence spectroscopy: Measure real-time translocation of fluorescently labeled lipid analogs with millisecond resolution.

  • Single-molecule FRET: Track individual translocation events to identify mechanistic intermediates.

  • Kinetic modeling: Apply advanced mathematical models incorporating:

    • Michaelis-Menten parameters for ATP hydrolysis (typical Km ~100-200 μM)

    • Substrate binding constants (Kd ~1-5 μM for Ara4N-modified lipids)

    • Rate-limiting step identification through temperature-dependent studies

  • Membrane tension effects: Systematically vary membrane curvature and tension using different liposome preparation techniques to quantify effects on activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.