Recombinant Escherichia coli O157:H7 Probable intracellular septation protein A (yciB)

Shipped with Ice Packs
In Stock

Description

Functional Roles in E. coli O157:H7

yciB contributes to bacterial survival and pathogenicity through:

Lipoprotein Maturation

  • yciB and DcrB form a synergistic system essential for lipoprotein diacylglyceryl transferase (Lgt) activity.

  • Loss of both proteins causes defective lipid modification of lipoproteins (e.g., Lpp), leading to their mislocalization to the IM and toxic peptidoglycan (PGN) crosslinking .

Stress Response Modulation

  • The yciB dcrB double mutant activates two envelope stress response (ESR) systems:

    • Rcs pathway: 10-fold upregulation due to mislocalized RcsF lipoprotein .

    • Cpx pathway: Independent of lipoprotein stress, suggesting broader membrane defects .

Membrane Homeostasis

  • yciB maintains membrane fluidity and fatty acid composition, critical for lipoprotein biogenesis under stress conditions like high salt .

Table 1: Key Phenotypes of yciB Mutants

MutationPhenotypeCitation
yciB single mutantMild Cpx activation; no lipoprotein maturation defects
yciB dcrB double mutantLethality due to Lpp-PGN crosslinking; Rcs/Cpx hyperactivation
yciB dcrB lpp mutantRestored growth; reduced Rcs activation

Table 2: Recombinant yciB Applications

ApplicationDetailsCitation
Vaccine developmentAntigen candidate for E. coli O157:H7 vaccines
Membrane biology studiesTool for analyzing lipoprotein processing and ESR pathways

Mechanistic Insights

  • Lipoprotein mislocalization: In yciB dcrB mutants, outer membrane (OM) lipoproteins (e.g., BamC, BamE, RcsF) accumulate in the IM, disrupting OM integrity .

  • Enzyme rescue: Overexpression of Lgt restores Rcs activity to wild-type levels in yciB dcrB mutants, confirming defective Lgt function as the primary defect .

Evolutionary and Pathogenic Context

  • yciB is conserved in pathogenic E. coli but absent in non-toxigenic strains (e.g., O55:H7) .

  • Its role in membrane homeostasis aligns with E. coli O157:H7’s adaptation to host environments, including resistance to bile salts and antimicrobial peptides .

Future Directions

  • Therapeutic targeting: Disrupting yciB-DcrB interactions could impair E. coli O157:H7 viability.

  • Vaccine optimization: Recombinant yciB’s immunogenicity in animal models warrants further study .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors including storage state, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; ECH74115_1741; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Target Names
yciB
Target Protein Sequence
MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVV FGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRMLGKELTLPQPVWSKLN LAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS
Uniprot No.

Target Background

Function
Plays a role in cell envelope biogenesis, maintenance of cell envelope integrity, and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the membrane topology of YciB in E. coli?

YciB is an inner membrane protein containing five transmembrane domains. The topology has been clarified through detailed membrane analysis, providing insight into how this protein is anchored and oriented within the bacterial membrane system . Understanding this topology is essential for interpreting the protein's interactions with other cell division and elongation components, as the specific arrangement of transmembrane domains determines which portions of the protein are available for protein-protein interactions in different cellular compartments.

What are the primary functional roles of YciB in E. coli O157:H7?

YciB appears to play a crucial role in cell envelope synthesis by interacting with cell elongation and cell division complexes . Research indicates that YciB works synergistically with DcrB (another inner membrane protein) to maintain cell envelope integrity. When both yciB and dcrB are deleted, the abundant outer membrane lipoprotein Lpp mislocalizes to the inner membrane, where it forms toxic linkages to peptidoglycan . This suggests YciB is involved in proper protein localization and maintaining membrane compartmentalization, which are essential processes for bacterial cell viability and division.

How does YciB contribute to bacterial cell envelope integrity?

YciB contributes to cell envelope integrity through its involvement in lipoprotein maturation pathways. Evidence suggests that in yciB dcrB double mutants, there is inefficient lipid modification at the first step in lipoprotein maturation, which is catalyzed by the enzyme Lgt (phosphatidylglycerol:preprolipoprotein diacylglyceryl transferase) . This defect leads to the mislocalization of lipoproteins, particularly Lpp, resulting in compromised envelope integrity. The proper functioning of YciB appears to be essential for maintaining the distinct compositions of the inner and outer membranes in Gram-negative bacteria.

What techniques are most effective for analyzing YciB protein interactions?

Bacterial two-hybrid systems have proven effective for identifying YciB's interactions with various proteins involved in cell elongation and cell division . This approach allows researchers to systematically map the protein interaction network of YciB. For more detailed interaction studies, techniques such as co-immunoprecipitation followed by mass spectrometry can provide confirmation of interactions and identify additional binding partners. Cross-linking experiments may also reveal transient interactions that occur during the dynamic process of cell division.

How can researchers effectively generate and characterize yciB deletion mutants?

Creating yciB deletion mutants requires careful consideration of growth conditions, as these mutants show susceptibility to low osmolarity environments . Successful characterization protocols typically include:

  • Using lambda Red recombination or CRISPR-Cas9 systems for precise gene deletion

  • Confirming deletions through PCR verification and sequencing

  • Phenotypic characterization under various osmotic conditions

  • Microscopic examination of cell morphology and division patterns

  • Membrane integrity assays to assess envelope defects

When studying yciB in combination with other mutations (such as dcrB), researchers should consider using conditional knockout systems, as some double mutants may be lethal under standard laboratory conditions .

What imaging techniques provide the most insight into YciB's role in cell division?

Advanced microscopy techniques offer valuable insights into YciB's function. Fluorescence microscopy using protein fusions (GFP-YciB) can reveal localization patterns during different stages of cell division. For studying membrane defects in yciB mutants, membrane-specific dyes like SynaptoRedC2/FM4-64 are effective for visualizing septum formation . Additionally, super-resolution microscopy techniques such as STORM or PALM can provide nanoscale details of YciB's localization and interactions during cell division. Transmission electron microscopy (TEM) remains valuable for examining detailed cellular ultrastructure in mutant strains.

How does YciB function differ between pathogenic E. coli O157:H7 and non-pathogenic E. coli strains?

While the fundamental function of YciB in membrane integrity appears consistent across E. coli strains, pathogenic E. coli O157:H7 may employ this protein differently in relation to virulence mechanisms. Research suggests that proper cell envelope maintenance is particularly important for pathogenic strains during host colonization. In E. coli O157:H7, which shows specific tissue tropism for the bovine rectal mucosa , YciB-mediated envelope integrity may be critical for survival during internalization by host cells. Comparative genomic and functional studies between pathogenic and non-pathogenic strains could reveal strain-specific adaptations in YciB structure or regulation.

Does YciB influence the internalization of E. coli O157:H7 by bovine rectal epithelial cells?

E. coli O157:H7 can penetrate deeply into the crypts of bovine terminal rectal mucosa and be internalized by bovine rectal epithelial cells . While direct evidence linking YciB to this process is limited, the protein's role in maintaining cell envelope integrity suggests it could indirectly influence internalization efficiency. Disruption of YciB function might alter the presentation of surface structures required for host cell interaction or affect bacterial survival following internalization. Research methods to investigate this connection would include internalization assays with wildtype and yciB-deficient E. coli O157:H7 strains using primary bovine rectal epithelial cells.

What proteins directly interact with YciB during cell division?

Bacterial two-hybrid analysis has revealed that YciB interacts with various proteins involved in cell elongation and cell division . These interaction partners likely include components of the divisome complex, which is responsible for bacterial cell division. Evidence suggests potential interactions with proteins involved in peptidoglycan synthesis, as YciB deletion combined with dcrB deletion leads to abnormal peptidoglycan linkages . Detailed interaction mapping would help clarify whether YciB functions as a structural component of the divisome or plays a regulatory role in coordinating division processes.

How does the interaction between YciB and DcrB contribute to cell envelope integrity?

The synergistic relationship between YciB and DcrB appears critical for maintaining cell envelope integrity. When both proteins are absent, the first step of lipoprotein maturation becomes inefficient, leading to mislocalization of the abundant outer membrane lipoprotein Lpp to the inner membrane . This suggests that YciB and DcrB may:

  • Directly or indirectly influence the activity of Lgt, the enzyme catalyzing the initial step in lipoprotein maturation

  • Contribute to proper membrane fluidity or lipid composition required for optimal Lgt function

  • Participate in quality control mechanisms that prevent the accumulation of improperly processed lipoproteins in the inner membrane

The viability of the yciB dcrB double mutant can be restored by increasing expression of Lgt, deleting lpp, or removing Lpp-peptidoglycan linkages , providing multiple avenues for investigating this interaction.

What cellular defects arise from yciB deletion in E. coli?

Deletion of yciB results in increased susceptibility to low osmolarity environments , suggesting impaired osmoregulation or membrane integrity. While a single yciB deletion may produce relatively mild phenotypes under standard laboratory conditions, combined deletion with other genes like dcrB reveals more severe defects. These include:

  • Mislocalization of the outer membrane lipoprotein Lpp to the inner membrane

  • Formation of toxic peptidoglycan-inner membrane linkages

  • Potential alterations in membrane fluidity and lipid homeostasis

These phenotypes highlight YciB's importance in maintaining proper envelope compartmentalization and function, particularly under stress conditions.

How does temperature affect the phenotype of yciB mutants?

Temperature affects membrane fluidity, which appears relevant to YciB function. Evidence indicates that dcrB null mutants are not viable when grown at low temperatures , suggesting that YciB's function becomes even more critical under these conditions. This temperature sensitivity may be due to further decreases in membrane fluidity that exacerbate defects in lipoprotein processing or membrane organization. Researchers studying yciB should carefully control temperature conditions, as temperature shifts may reveal phenotypes not observable under standard laboratory temperatures.

How does YciB functionally relate to ZapG and other Z-ring associated proteins?

Both YciB and ZapG (YhcB/DUF1043) are involved in cell division processes in gamma-proteobacteria . While ZapG has been characterized as a Z-ring-associated protein with a unique tetrameric α-helical coiled-coil structure that likely links the Z-ring to septal peptidoglycan-synthesizing complexes , YciB's precise relationship to the Z-ring remains less defined. YciB may function in parallel pathways that coordinate membrane remodeling with peptidoglycan synthesis during cell division. Comparative studies of cells lacking both proteins could reveal functional redundancies or synthetic interactions.

How might the function of YciB be exploited for antimicrobial development?

Given YciB's role in maintaining cell envelope integrity, particularly in conjunction with DcrB, it represents a potential target for novel antimicrobial strategies. Compounds that interfere with YciB function might sensitize bacteria to osmotic stress or disrupt cell division. A strategic research approach would include:

  • High-throughput screening for small molecules that bind to YciB

  • Assessing whether YciB inhibition synergizes with existing antibiotics that target cell wall synthesis

  • Evaluating the potential for narrow-spectrum activity against pathogenic E. coli strains

  • Development of peptide inhibitors that disrupt critical YciB protein-protein interactions

This research direction requires detailed structural information about YciB and its interaction interfaces.

What experimental approaches could resolve contradictory findings about YciB function?

Some aspects of YciB function may appear contradictory across different studies or experimental systems. To resolve such contradictions, researchers should consider:

  • Strain-specific differences in YciB function or regulation

  • Growth condition variations that may mask or reveal phenotypes

  • Compensatory mechanisms that activate in response to yciB deletion

  • Development of time-resolved experiments to capture the dynamic nature of YciB's role during cell division

Multi-omics approaches combining transcriptomics, proteomics, and lipidomics of wildtype and mutant strains under various conditions would provide a systems-level understanding of YciB function and resolve apparent contradictions in the literature.

What are the most effective methods for purifying YciB for structural studies?

Purification of membrane proteins like YciB presents significant technical challenges. Effective approaches include:

  • Use of mild detergents (DDM, LMNG) that maintain protein structure while solubilizing membrane components

  • Incorporation of stability-enhancing mutations or fusion partners

  • Nanodiscs or amphipol systems to maintain a membrane-like environment

  • Expression in specialized bacterial strains optimized for membrane protein production

For structural studies, researchers should consider a combination of X-ray crystallography, cryo-electron microscopy, and NMR spectroscopy to obtain comprehensive structural information.

How can researchers distinguish direct versus indirect effects of yciB deletion?

Distinguishing direct versus indirect effects of yciB deletion requires careful experimental design:

  • Complementation experiments using wild-type yciB expressed from plasmids to confirm phenotype rescue

  • Point mutations that affect specific functions rather than complete gene deletion

  • Temporal control of gene expression using inducible systems to observe immediate versus long-term effects

  • Suppressor screens to identify genes that can compensate for yciB deletion, revealing functional pathways

Additionally, direct biochemical assays of processes suspected to be directly affected by YciB, such as lipoprotein processing or peptidoglycan synthesis, can provide evidence for direct functional relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.