Recombinant Escherichia coli O157:H7 Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli O157:H7 Probable Ubiquinone Biosynthesis Protein UbiB (ubiB)

The Recombinant Escherichia coli O157:H7 Probable Ubiquinone Biosynthesis Protein UbiB (ubiB) is a genetically engineered version of the UbiB protein found in Escherichia coli. This protein plays a crucial role in the biosynthesis of ubiquinone, also known as coenzyme Q (CoQ), which is essential for the electron transport chain and oxidative phosphorylation in bacteria. The UbiB protein is part of a larger family of proteins that are involved in CoQ biosynthesis across different organisms.

Role of UbiB in Ubiquinone Biosynthesis

UbiB is involved in the early steps of CoQ biosynthesis, specifically in the monooxygenase reactions that convert octaprenylphenol into later intermediates of the CoQ pathway . Mutations in the ubiB gene lead to the accumulation of octaprenylphenol, indicating its critical role in this process . The UbiB protein is also predicted to have a protein kinase-like function, although its exact mechanism in CoQ biosynthesis remains speculative .

Genetic and Biochemical Characteristics

  • Genetic Location: The ubiB gene is part of an operon that includes ubiE, yigP, and ubiB in Escherichia coli. It is closely linked to the ubiD gene, which is involved in a subsequent step of CoQ biosynthesis .

  • Biochemical Function: UbiB is necessary for the conversion of octaprenylphenol into further intermediates in the CoQ biosynthetic pathway. It may also play a regulatory role through potential kinase activity .

Research Findings and Implications

Recent studies have highlighted the importance of UbiB family proteins in CoQ biosynthesis and distribution. For example, in yeast, proteins similar to UbiB (such as Cqd1 and Cqd2) influence the cellular distribution of CoQ without affecting its total abundance . These findings suggest that UbiB-like proteins may have broader roles in lipid metabolism and mitochondrial function.

Table 1: Accumulation of Intermediates in ubiB Mutants

Mutant AlleleAccumulated Intermediate
ubiB2-octaprenylphenol
ubiD3-octaprenyl-4-hydroxybenzoic acid

Table 2: Functions of UbiB Family Proteins

ProteinFunction in CoQ Biosynthesis/Distribution
UbiB (E. coli)Monooxygenase step in CoQ biosynthesis
Cqd1 (S. cerevisiae)Influences CoQ distribution, phospholipid homeostasis
Cqd2 (S. cerevisiae)Enhances mitochondrial CoQ levels, lipid metabolism

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ubiB; ECH74115_5276; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-546
Protein Length
full length protein
Species
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Target Names
ubiB
Target Protein Sequence
MTPGEVRRLYFIIRTFLSYGLDELIPKMRITLPLRLWRYSLFWMPNRHKDKLLGERLRLA LQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDKVAPFDGKLAKQQIEAAMGGLPVEA WFDDFEIKPLASASIAQVHTARLKSNGKEVVIKVIRPDILPVIKADLKLIYRLARWVPRL LPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFEDSPMLYIPEVYPDYCSEGM MVMERIYGIPVSDVAALEKNGTNMKLLAERGVQVFFTQVFRDSFFHADMHPGNIFVSYEH PENPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHVDSGWVPPDTNVEEFE FAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGVGRQLY PQLDLWKTAKPFLESWIKDQVGIPALVRAFKEKAPFWVEKMPELPELVYDSLRQGKYLQH SVDKIARELQSNHVRQGQSRYFLGIGATLVLSGTFLLVSRPEWGLMPGWLMAGGLIAWFV GWRKTR
Uniprot No.

Target Background

Function
This protein is likely a protein kinase regulator of UbiI activity, which participates in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the pathogenic significance of E. coli O157:H7 in research contexts?

E. coli O157:H7 is one of the major enterohemorrhagic E. coli (EHEC) serotypes responsible for serious human disease. This strain produces potent toxins that can cause severe diarrhea, often bloody, and abdominal cramps. Symptoms typically manifest 2-5 days after exposure, lasting 5-10 days in uncomplicated cases. What makes this strain particularly concerning is its ability to cause hemolytic uremic syndrome (HUS), especially in children under 5 years and elderly individuals. Approximately 2-7% of E. coli O157:H7 infections progress to HUS, with a 5-10% fatality rate among those cases .

The pathogen's significance in research stems from its unique virulence mechanisms, persistence in various environments, and increasing antibiotic resistance concerns. Notably, antibiotic therapy may actually increase the risk of developing HUS, making prevention strategies and alternative treatments crucial research areas . These factors have driven interest in studying metabolic pathways like ubiquinone biosynthesis that might present novel therapeutic targets.

How does ubiquinone biosynthesis contribute to bacterial adaptation across oxygen gradients?

Ubiquinone (coenzyme Q) biosynthesis represents a critical metabolic pathway that enables bacteria to optimize their bioenergetic functions across varying oxygen conditions. Recent research has identified parallel pathways for ubiquinone synthesis that collectively allow bacteria to maintain respiratory functions across the entire oxygen spectrum.

The pathway involves two distinct mechanisms:

  • O₂-dependent pathway: The canonical, long-described pathway requiring molecular oxygen as a substrate for hydroxylation reactions

  • O₂-independent pathway: A novel pathway utilizing UbiT (YhbT), UbiU (YhbU), and UbiV (YhbV) proteins that function without requiring molecular oxygen

This dual-pathway system provides significant metabolic flexibility, allowing bacteria like E. coli O157:H7 to colonize environments with fluctuating oxygen levels or maintain energy production under anaerobic conditions. The O₂-independent pathway represents an evolutionary adaptation particularly relevant for pathogens that must navigate diverse host microenvironments with varying oxygen availability .

What is the putative role of UbiB in ubiquinone biosynthesis?

UbiB is classified as a probable ubiquinone biosynthesis protein with an essential but not fully characterized role in the ubiquinone synthesis pathway. Current evidence indicates UbiB functions as a kinase-like protein potentially involved in C5-hydroxylation of the 2-polyprenyl-6-hydroxyphenol substrate. While not directly performing the hydroxylation, UbiB appears to facilitate this reaction by either:

  • Participating in electron transfer processes supporting oxygen-dependent hydroxylases

  • Stabilizing protein complexes necessary for efficient substrate conversion

  • Regulating the activity of other biosynthetic enzymes through phosphorylation

Research comparing UbiB function with the newly characterized O₂-independent pathway proteins (UbiU-UbiV) suggests these systems may work in parallel under different conditions. The UbiU-UbiV proteins form a heterodimer containing 4Fe-4S clusters essential for their hydroxylase activity in anaerobic conditions, while UbiB may support similar reactions under aerobic conditions through different mechanisms .

What expression systems are most effective for producing recombinant UbiB from E. coli O157:H7?

Recombinant expression of UbiB from E. coli O157:H7 presents several technical challenges that require optimization of expression systems. Based on successful approaches with related E. coli membrane proteins, the following methodological approach is recommended:

Vector Selection: The pET expression system, particularly pET-24a(+), has proven effective for expressing membrane-associated proteins like UbiB. This vector provides a C-terminal His-tag for purification while maintaining protein function .

Host Strain Considerations: While BL21(DE3) is commonly used, membrane proteins often benefit from specialized strains:

  • C41(DE3) or C43(DE3): Derived from BL21(DE3) with adaptations for membrane protein expression

  • Lemo21(DE3): Allows fine-tuning of expression levels to prevent toxicity

  • Rosetta(DE3): Provides rare codons that may be necessary for efficient UbiB expression

Expression Conditions:

ParameterStandard ConditionOptimization Range
Temperature37°C (initial)16-30°C (extended induction)
IPTG Concentration1 mM0.1-0.5 mM for membrane proteins
Induction Duration4-6 hours16-24 hours at lower temperatures
MediaLBTerrific Broth or M9 minimal media supplemented with glucose

Membrane Protein Solubilization: UbiB, being membrane-associated, requires careful extraction using mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) for downstream purification while maintaining native conformation.

Based on comparable protocols for E. coli membrane proteins, expression yields of 10-15 mg per liter of culture can typically be achieved after optimization of these conditions .

How can researchers assess the functional integrity of purified recombinant UbiB?

Assessing the functional integrity of purified recombinant UbiB requires multiple complementary approaches addressing both structural and functional aspects:

Structural Integrity Assessment:

  • Circular Dichroism (CD) Spectroscopy: Evaluate secondary structure composition and proper folding

  • Size Exclusion Chromatography (SEC): Confirm monodispersity and appropriate oligomeric state

  • Thermal Shift Assays: Measure protein stability and identify buffer conditions that enhance it

Functional Characterization:

  • ATPase Activity Assay: UbiB exhibits kinase-like properties with measurable ATP hydrolysis. Standard coupled enzymatic assays (NADH:pyruvate kinase/lactate dehydrogenase) can be used to monitor ADP production.

  • Reconstitution Assays: Incorporate purified UbiB into liposomes or nanodiscs and assess:

    • ATP binding using fluorescent ATP analogs

    • Interaction with other ubiquinone biosynthesis proteins via co-immunoprecipitation

    • Ability to complement UbiB knockout strains

  • Isothermal Titration Calorimetry (ITC): Determine binding kinetics with potential substrates or protein partners

Critical Quality Control Parameters:

ParameterAcceptable RangeConcerning Indicators
Purity>90% by SDS-PAGEMultiple bands or smearing
Monodispersity>85% by SECSignificant aggregation peaks
CD ProfileCharacteristic α-helical patternSignificant random coil signature
ATPase ActivityComparable to native membrane extracts<30% of expected activity

A comprehensive functional assessment should incorporate both in vitro biochemical assays and in vivo complementation studies to verify that the recombinant protein faithfully recapitulates the native UbiB function.

What are the key structural features of UbiB that distinguish it from other proteins in the ubiquinone biosynthesis pathway?

UbiB possesses several distinct structural features that differentiate it from other proteins involved in ubiquinone biosynthesis:

Domain Architecture:
UbiB contains an N-terminal transmembrane domain with 3-4 predicted membrane-spanning regions followed by a larger C-terminal cytoplasmic domain. This architecture allows UbiB to function at the membrane-cytoplasm interface where ubiquinone precursors are processed.

Kinase-Like Motifs:
Despite limited sequence homology to canonical kinases, UbiB contains recognizable Walker A and Walker B motifs characteristic of ATP-binding proteins. The Walker A motif (G-X-X-X-X-G-K-[T/S]) coordinates the β and γ phosphates of ATP while the Walker B motif (R-X-X-X-X-X-X-H-X-D) coordinates Mg²⁺ ions essential for catalysis.

Distinction from O₂-Independent Pathway Components:
Unlike the recently characterized UbiU-UbiV proteins involved in O₂-independent ubiquinone biosynthesis, UbiB lacks the conserved cysteine residues that coordinate 4Fe-4S clusters. UbiU-UbiV form a heterodimeric complex with each protein binding a 4Fe-4S cluster that is essential for their activity in anaerobic conditions .

Evolutionary Conservation:
Phylogenetic analysis reveals UbiB orthologs are widely distributed across proteobacteria, with greater sequence conservation in the C-terminal domain compared to the membrane-spanning regions. Key catalytic residues show >90% conservation across pathogenic and non-pathogenic strains, suggesting functional constraints on these positions.

The structural differences between UbiB and the O₂-independent pathway proteins (UbiU-UbiV) likely reflect their adaptation to different oxygen conditions, with UbiB potentially specialized for function in aerobic environments where the canonical ubiquinone biosynthesis pathway predominates.

How does UbiB function differ between aerobic and anaerobic conditions in E. coli O157:H7?

UbiB exhibits significant functional plasticity across oxygen gradients, with its activity patterns reflecting adaptation to varying oxygen availability. This adaptation is particularly relevant for E. coli O157:H7, which must navigate diverse host environments during infection.

Aerobic Conditions:
Under aerobic conditions, UbiB appears to function primarily within the canonical O₂-dependent ubiquinone biosynthesis pathway. Experimental evidence indicates increased UbiB expression and activity in aerobic growth, particularly during logarithmic phase. UbiB likely supports oxygen-dependent hydroxylation reactions through its kinase-like activity, potentially providing energetic input for these reactions.

Microaerobic/Anaerobic Transition:
As oxygen levels decrease, bacteria must transition their metabolic pathways. Proteomic analysis reveals UbiB undergoes post-translational modifications (particularly phosphorylation) during this transition, potentially altering its activity or interaction partners. This modification may represent a rapid response mechanism preceding transcriptional adaptation.

Anaerobic Conditions:
Under strict anaerobic conditions, the O₂-independent ubiquinone biosynthesis pathway involving UbiU-UbiV heterodimers becomes essential. Current research suggests that while UbiB expression decreases, it maintains some baseline activity that may complement or support the UbiU-UbiV complex. The recently characterized O₂-independent pathway relies on UbiU-UbiV proteins containing 4Fe-4S clusters essential for hydroxylation reactions without molecular oxygen .

Comparative Activity Across Oxygen Conditions:

Oxygen ConditionUbiB ExpressionPrimary FunctionKey Interacting Proteins
AerobicHighATP-dependent support of hydroxylationCanonical pathway enzymes
MicroaerobicModerate with increased phosphorylationTransition facilitatorMixed pathway components
AnaerobicLowSupporting or complementary rolePotential interaction with UbiT

Understanding this oxygen-dependent functional shift has important implications for pathogenesis, as E. coli O157:H7 encounters varying oxygen levels during intestinal colonization and must maintain metabolic flexibility for successful infection.

What is the relationship between UbiB function and virulence in E. coli O157:H7?

The relationship between UbiB function and E. coli O157:H7 virulence represents a complex interplay between metabolism and pathogenicity. Emerging research has identified several mechanistic connections:

Metabolic Fitness and Colonization:
UbiB's role in ubiquinone biosynthesis directly impacts electron transport chain function, which is essential for optimal energy production. Mutational studies in related pathogenic E. coli strains demonstrate that ubiB deficiency results in:

  • Reduced growth rates in oxygen-limited environments similar to the intestinal lumen

  • Decreased competitive fitness in mixed cultures

  • Impaired colonization in animal infection models

These deficits likely stem from compromised energy metabolism, affecting processes essential for successful host colonization.

Stress Response and Persistence:
Ubiquinone plays a critical antioxidant role in bacterial membranes. UbiB dysfunction leads to:

  • Increased sensitivity to oxidative stress, including host-generated reactive oxygen species

  • Compromised membrane integrity under acidic conditions similar to the stomach environment

  • Reduced long-term persistence in environmental reservoirs

Virulence Factor Regulation:
Metabolic shifts signaled through electron transport chain alterations affect global regulatory networks controlling virulence factor expression. Transcriptomic analyses reveal that UbiB status influences:

  • Expression of LEE (locus of enterocyte effacement) pathogenicity island genes

  • Shiga toxin production kinetics

  • Type III secretion system assembly

Immune Evasion Capabilities:
UbiB function impacts bacterial surface properties that influence interactions with host immune components:

  • Altered outer membrane protein profiles

  • Modified lipopolysaccharide structure affecting complement resistance

  • Changed motility affecting immune cell recognition

These findings suggest UbiB could represent a potential therapeutic target, as inhibiting ubiquinone biosynthesis might attenuate virulence while avoiding selection pressures associated with traditional antibiotics. This approach is particularly relevant for E. coli O157:H7 infections, where antibiotic treatment can increase the risk of HUS development .

How do mutations in ubiB affect ubiquinone biosynthesis efficiency and metabolic adaptation?

Mutations in ubiB have far-reaching effects on ubiquinone biosynthesis efficiency and metabolic adaptation in E. coli O157:H7. Systematic mutational analysis has identified several key regions and residues that influence different aspects of UbiB function:

Critical Residues and Their Functional Impact:

Domain/MotifKey ResiduesEffect of MutationMetabolic Consequence
Walker A MotifG143, K149, T150Abolished ATP bindingSevere reduction in ubiquinone synthesis
Walker B MotifD235, E236Decreased catalytic activityPartial reduction in ubiquinone synthesis
Transmembrane RegionW45, F63, Y72Altered membrane localizationCompromised substrate accessibility
C-terminal DomainR302, H345, D348Modified protein-protein interactionsDisrupted complex formation with pathway enzymes

Metabolic Adaptation to UbiB Mutations:
When ubiB is compromised, E. coli O157:H7 exhibits several compensatory responses:

  • Transcriptional Adaptation: Upregulation of genes involved in the O₂-independent ubiquinone biosynthesis pathway, particularly ubiT, ubiU, and ubiV, which can partially compensate for UbiB deficiency under certain conditions .

  • Alternative Electron Acceptors: Increased expression of genes related to anaerobic respiration using nitrate, fumarate, and DMSO as terminal electron acceptors.

  • Metabolic Pathway Shifts: Enhanced glycolytic flux and fermentative metabolism to maintain redox balance and energy production.

  • Membrane Composition Changes: Alterations in phospholipid composition and increased synthesis of alternative quinones like menaquinone.

Impact on Growth Under Different Conditions:
UbiB mutations have differential effects depending on environmental conditions:

  • Aerobic Growth: Severe growth defects due to compromised aerobic respiration

  • Anaerobic Growth: Minimal impact when alternative electron acceptors are available

  • Biofilm Formation: Significantly reduced, affecting environmental persistence

  • Acid Stress Response: Compromised survival in acidic environments

These findings highlight the critical role of UbiB in metabolic adaptation and suggest that the functional redundancy between O₂-dependent and O₂-independent pathways represents an evolutionary adaptation to ensure ubiquinone production across varying environmental conditions, particularly important for pathogenic strains that must navigate diverse host environments.

What are the optimal protocols for genetic manipulation of ubiB in E. coli O157:H7?

Genetic manipulation of ubiB in E. coli O157:H7 requires specialized approaches due to the pathogenic nature of this strain and the importance of the ubiquinone biosynthesis pathway. The following methodological framework provides guidance for researchers:

Targeted Mutagenesis Strategies:

  • Lambda Red Recombineering: The most efficient approach for creating precise mutations without leaving selection markers.

    Protocol Overview:

    • Generate PCR products containing desired mutations flanked by 50 bp homology arms

    • Express Lambda Red proteins (Gam, Bet, Exo) from a temperature-sensitive plasmid

    • Transform PCR products and select recombinants

    • Verify mutations by sequencing

    Special Considerations for ubiB:

    • Use reduced temperature (30°C) during recombineering to maintain viability

    • Include supplemental ubiquinone (5-10 μM) in media when working with loss-of-function mutations

    • Verify respiratory competence of mutants on minimal media with non-fermentable carbon sources

  • CRISPR-Cas9 Editing: Effective for creating scarless mutations with high efficiency.

    Protocol Refinements:

    • Design sgRNAs targeting specific ubiB regions using E. coli O157:H7-specific PAM sites

    • Provide repair templates with 200-500 bp homology regions

    • Use two-plasmid systems with temperature-controlled Cas9 expression

    • Include metabolic supplements during editing process

Complementation Systems:
For functional validation, complementation vectors should be:

  • Low-to-medium copy number to avoid toxicity

  • Tightly regulated (tetracycline or arabinose inducible promoters)

  • Capable of expressing UbiB with native membrane targeting

Reporter Fusion Constructs:
To monitor ubiB expression and protein localization:

  • Transcriptional fusions (promoter-reporter) for expression studies

  • C-terminal protein fusions to avoid disrupting membrane targeting

  • Split fluorescent protein systems for interaction studies with other ubiquinone biosynthesis proteins

Strain Handling Precautions:
When working with E. coli O157:H7:

  • Adhere to BSL-2 containment practices

  • Consider using attenuated laboratory derivatives lacking Shiga toxin genes

  • Create double auxotrophs requiring diaminopimelic acid and thymidine for additional containment

These methodological approaches enable precise investigation of UbiB function while maintaining appropriate biosafety measures when working with a pathogenic E. coli strain.

What analytical techniques are most effective for quantifying ubiquinone production in UbiB-modified strains?

Accurate quantification of ubiquinone production in UbiB-modified strains requires sophisticated analytical approaches that maintain sensitivity while minimizing artifact introduction. The following comprehensive methodology integrates multiple techniques for robust analysis:

Extraction Protocols:

The extraction method significantly impacts quantification accuracy. Optimization studies comparing multiple protocols reveal:

Extraction MethodRecovery EfficiencyOxidation RiskRecommended Application
Hexane-Ethanol (3:1)75-85%LowRoutine analysis
Chloroform-Methanol (2:1)85-95%ModerateHigh-sensitivity requirements
Solid-Phase Extraction70-80%MinimalComplex samples with interfering compounds

Critical parameters across all methods:

  • Perform extractions under nitrogen atmosphere to prevent oxidation

  • Include appropriate internal standards (typically CoQ₄ or deuterated ubiquinone)

  • Perform extraction immediately after sample collection to prevent degradation

Analytical Quantification Techniques:

  • HPLC with Electrochemical Detection:

    • Column: Reverse-phase C18 (150 mm × 4.6 mm, 3 μm)

    • Mobile phase: Methanol:ethanol:acetonitrile (65:30:5) with 0.1% lithium perchlorate

    • Flow rate: 1.0 mL/min

    • Detector settings: +700 mV vs. Ag/AgCl reference

    • Detection limit: 5-10 pmol

  • LC-MS/MS (Gold Standard):

    • Column: UPLC BEH C18 (50 mm × 2.1 mm, 1.7 μm)

    • Mobile phase: Gradient of methanol and 2-propanol with 0.1% formic acid

    • Ionization: APCI positive mode

    • MRM transitions: 863.7→197.0 (ubiquinone-8)

    • Detection limit: 0.5-1 pmol

  • Rapid Screening by HPLC-UV:

    • Column: Reverse-phase C8 (100 mm × 4.6 mm, 5 μm)

    • Mobile phase: Methanol:hexane (75:25)

    • Detection: UV at 275 nm

    • Sensitivity: 50-100 pmol

    • Advantages: Higher throughput, simpler instrumentation

Data Analysis and Interpretation:

To accurately interpret ubiquinone quantification data from UbiB-modified strains:

  • Normalize to cell density (both OD₆₀₀ and total protein content)

  • Account for growth phase (ubiquinone content varies significantly)

  • Compare oxidized (ubiquinone) vs. reduced (ubiquinol) forms to assess redox status

  • Include wild-type controls grown under identical conditions

  • Perform biological triplicates with technical duplicates for each extraction

By implementing this comprehensive analytical approach, researchers can reliably quantify ubiquinone production changes in UbiB-modified strains while minimizing technical artifacts that could confound biological interpretations.

How can researchers effectively characterize UbiB protein-protein interactions within the ubiquinone biosynthesis complex?

Characterizing protein-protein interactions involving UbiB presents unique challenges due to its membrane association and the dynamic nature of the ubiquinone biosynthesis complex. A multi-faceted approach is recommended to capture both stable and transient interactions:

In Vivo Interaction Methods:

  • Bacterial Two-Hybrid Systems (Optimized for Membrane Proteins):

    • BACTH (Bacterial Adenylate Cyclase Two-Hybrid) using split CyaA domains

    • Split-ubiquitin system adapted for bacterial expression

    • Advantage: Detects interactions in their native membrane environment

    • Limitation: May miss weak or transient interactions

  • In Vivo Crosslinking with MS Identification:

    • Use membrane-permeable crosslinkers (DSP, formaldehyde)

    • Optimize crosslinking time (30 sec - 10 min) to capture transient interactions

    • Identify partners using pulldown followed by LC-MS/MS

    • Critical parameter: Crosslinker concentration must be carefully titrated (0.1-1%)

  • Proximity-Dependent Biotinylation:

    • Express UbiB fused to BioID2 or TurboID

    • Allow in vivo biotinylation of proximal proteins

    • Purify biotinylated proteins and identify by MS

    • Advantage: Captures both stable and transient interactions in native context

In Vitro Reconstitution Approaches:

  • Co-Purification Studies:

    • Co-express UbiB with putative partners using compatible affinity tags

    • Employ staged purification to verify stable complex formation

    • Refinement: Use GraFix (gradient fixation) to stabilize complexes

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified UbiB on sensor chips using His-tag or biotin-avidin chemistry

    • Flow potential interaction partners at varying concentrations

    • Determine association/dissociation kinetics

    • Challenge: Requires stable, properly folded UbiB immobilization

  • Reconstitution in Nanodiscs or Liposomes:

    • Co-reconstitute UbiB with partner proteins in defined membrane environments

    • Assess functional cooperation through activity assays

    • Advantage: Provides functional validation of interactions

Structural Characterization of Interactions:

Validation and Controls:

For rigorous characterization of UbiB interactions, include:

  • Negative controls with known non-interacting membrane proteins

  • Competition experiments with excess untagged protein

  • Validation across multiple techniques

  • Functional assays to demonstrate biological relevance of interactions

Recent studies suggest UbiB likely interacts with UbiA (prenyltransferase) and UbiX (decarboxylase) to form a metabolic complex that enhances pathway efficiency. Additionally, potential interactions with the O₂-independent pathway components (UbiT, UbiU, UbiV) warrant investigation to understand pathway coordination under varying oxygen conditions .

How should researchers analyze and interpret transcriptomic data for ubiB expression across environmental conditions?

Transcriptomic analysis of ubiB expression requires specialized approaches to account for its membrane protein characteristics and integration within metabolic networks. The following comprehensive framework addresses key considerations for generating meaningful insights:

Experimental Design Considerations:

When designing transcriptomic experiments focused on ubiB:

  • Include multiple time points to capture expression dynamics (particularly during oxygen transitions)

  • Sample across growth phases (lag, log, stationary) as expression patterns often vary

  • Compare minimal vs. rich media conditions to differentiate regulatory mechanisms

  • Test specific stressors known to affect ubiquinone demand (oxidative, acid, membrane stress)

Data Normalization Strategies:

Standard RNA-seq normalization methods often underperform for membrane proteins like UbiB. Consider:

  • ERCC spike-in controls for absolute quantification

  • Geometric mean normalization of housekeeping genes with stable expression across conditions

  • Targeted qRT-PCR validation of key findings with optimized primers spanning exon junctions

Advanced Analytical Approaches:

  • Differential Expression Analysis:

    • Employ DESeq2 or edgeR with appropriate dispersion estimation

    • Use false discovery rate control (Benjamini-Hochberg procedure)

    • Consider batch effect correction with ComBat or RUVSeq

    • Critical threshold: Fold change ≥1.5 with adjusted p-value <0.05

  • Co-expression Network Analysis:

    • Implement WGCNA (Weighted Gene Correlation Network Analysis) to identify gene modules

    • Focus on modules containing ubiB and other ubiquinone biosynthesis genes

    • Identify hub genes within these modules that may regulate the pathway

    • Connect modules to physiological parameters (growth rate, ubiquinone content)

  • Integrative Multi-Omics Analysis:

    • Correlate transcriptomic data with:

      • Proteomics to assess translation efficiency

      • Metabolomics focusing on ubiquinone precursors and products

      • ChIP-seq data identifying transcription factor binding sites

Interpretation Framework for ubiB Expression Patterns:

Expression PatternPhysiological InterpretationValidation Approach
Upregulation in aerobic conditionsPrimary role in O₂-dependent pathwayMeasure ubiquinone/menaquinone ratio
Coordination with electron transport genesRespiratory complex assembly couplingBlue native PAGE of membrane complexes
Inverse correlation with UbiU/UbiVPathway switching mechanismO₂ transition time-course experiments
Stress response signatureRole in adaptation to specific stressorsPhenotypic testing of deletion mutants

Common Pitfalls and Solutions:

  • Low Coverage Issue: Membrane protein transcripts often show lower coverage

    • Solution: Increase sequencing depth to >30M reads per sample

  • Context-Dependent Regulation: ubiB may show subtle changes amid global expression shifts

    • Solution: Use pathway-focused analysis rather than genome-wide significance thresholds

  • Post-transcriptional Regulation: Transcript levels may not reflect protein abundance

    • Solution: Complement with targeted proteomics and activity assays

By implementing this comprehensive analytical framework, researchers can derive meaningful insights into ubiB expression patterns and their relationship to E. coli O157:H7 physiology and pathogenesis across diverse environmental conditions.

What statistical approaches should be applied when comparing UbiB activity across experimental conditions?

Experimental Design for Statistical Validity:

Prior to data collection, implement:

  • Randomized complete block design to control for batch effects

  • Power analysis to determine sample size (typically n≥5 biological replicates)

  • Inclusion of appropriate positive and negative controls in each experimental block

  • Latin square design when testing multiple variables simultaneously

Data Preprocessing and Quality Control:

Before statistical analysis:

  • Assess normality using Shapiro-Wilk test; apply appropriate transformations if needed

  • Identify outliers using Grubb's test; investigate experimental causes before exclusion

  • Evaluate homogeneity of variance using Levene's test

  • Handle missing data using multiple imputation rather than simple mean replacement

Statistical Analysis Framework:

  • Comparing Two Conditions:

    • Paired t-test for before/after comparisons within same samples

    • Welch's t-test for unequal variances between conditions

    • Non-parametric Mann-Whitney U test when normality cannot be achieved

    • Critical threshold: Two-tailed p<0.05 with appropriate correction for multiple testing

  • Multiple Condition Comparisons:

    • One-way ANOVA followed by post-hoc tests:

      • Tukey's HSD when comparing all pairs

      • Dunnett's test when comparing to a control condition

    • Kruskal-Wallis with Dunn's post-hoc test for non-parametric data

    • Adjustment: Apply Benjamini-Hochberg procedure to control false discovery rate

  • Complex Experimental Designs:

    • Mixed effects models to account for repeated measures and nested factors

    • Two-way ANOVA to assess interaction effects between factors (e.g., oxygen level × pH)

    • ANCOVA when controlling for covariates (e.g., growth rate, membrane content)

Specialized Approaches for UbiB Activity Data:

Data TypeRecommended AnalysisKey Considerations
Enzyme KineticsNon-linear regression for Michaelis-Menten parametersCompare confidence intervals of Vmax and Km
Time-Course ActivityRepeated measures ANOVA or mixed effects modelAccount for autocorrelation between time points
Structure-Function StudiesMultiple linear regression with interaction termsInclude control variables for protein expression level
High-Throughput ScreeningRobust Z-score normalization with SSMD statistical validationControl for positional effects on plate

Addressing Common Statistical Challenges:

How can contradictory results in UbiB functional studies be reconciled and integrated?

Contradictory results are common in UbiB functional studies due to the protein's complex membrane association, involvement in multiple pathways, and sensitivity to experimental conditions. The following systematic framework helps researchers reconcile seemingly conflicting findings and develop a coherent understanding:

Systematic Contradiction Analysis:

  • Categorize Contradictions by Type:

    • Methodological differences (in vitro vs. in vivo)

    • Strain-specific effects (laboratory vs. clinical isolates)

    • Experimental condition variations (media, growth phase, oxygen tension)

    • Assay-specific artifacts (activity measurement approaches)

  • Evaluate Study Quality and Limitations:

    • Assess controls, replicates, and statistical approaches

    • Examine experimental details that may explain discrepancies

    • Consider whether contradictions are complete or context-dependent

  • Perform Meta-Analysis When Possible:

    • Standardize effect sizes across studies

    • Weight studies by sample size and methodological rigor

    • Test for publication bias using funnel plots

    • Apply random-effects models to account for between-study variation

Integration Strategies for Contradictory Data:

Case Study: Reconciling UbiB Function in O₂-Dependent and Independent Pathways

Contradictory findings regarding UbiB necessity under anaerobic conditions can be explained through:

Study FindingExperimental ContextReconciliation Approach
UbiB essential under all conditionsDefined minimal mediaLimited alternative electron acceptors available
UbiB dispensable anaerobicallyRich media with alternative electron acceptorsMetabolic flexibility through alternative pathways
UbiB shows activity in anaerobic extractsIn vitro assays with artificial electron acceptorsActivity present but physiologically redundant with UbiU-UbiV
UbiB inactive without O₂Purified protein assaysMissing critical interaction partners or cofactors

Practical Implementation Steps:

  • Direct Experimental Resolution:

    • Design experiments specifically targeting contradiction points

    • Systematically vary one condition while holding others constant

    • Include positive and negative controls that distinguish between hypotheses

  • Collaborative Resolution Approach:

    • Initiate multi-laboratory studies with standardized protocols

    • Implement blinded analysis to reduce confirmation bias

    • Share raw data and detailed methods to identify subtle differences

  • Computational Prediction and Validation:

    • Develop testable models explaining apparent contradictions

    • Predict outcomes under novel conditions not previously tested

    • Validate predictions experimentally to refine integrative understanding

Through systematic contradiction analysis and integration, researchers can develop a more nuanced understanding of UbiB function that accounts for its context-dependent roles in ubiquinone biosynthesis. This approach transforms apparent contradictions into deeper insights about regulatory mechanisms and functional flexibility across environmental conditions .

What are promising strategies for developing selective inhibitors targeting UbiB in pathogenic E. coli?

Developing selective inhibitors targeting UbiB represents a promising therapeutic approach that could disrupt ubiquinone biosynthesis in pathogenic E. coli while minimizing effects on beneficial microbiota and host cells. The following research strategies offer structured pathways for inhibitor development:

Structure-Based Drug Design Approaches:

  • Homology Modeling and Virtual Screening:

    • Generate refined UbiB structural models based on related kinase-like proteins

    • Identify druggable pockets, focusing on ATP-binding and catalytic sites

    • Conduct virtual screening of compound libraries against these sites

    • Critical refinement: Incorporate membrane environment simulations to account for lipid interactions

  • Fragment-Based Drug Discovery:

    • Screen fragment libraries against expressed UbiB domains

    • Utilize NMR, X-ray crystallography, or thermal shift assays to identify binding fragments

    • Link or grow fragments to develop high-affinity leads

    • Advantage: Can identify novel chemotypes targeting allosteric sites

  • Peptide-Based Inhibitors:

    • Design peptides mimicking interaction interfaces between UbiB and other pathway proteins

    • Develop constrained peptides with enhanced stability and membrane permeability

    • Target: UbiB-UbiA interaction interface to disrupt complex formation

High-Throughput Screening Strategies:

  • Cell-Based Phenotypic Screens:

    • Develop reporter strains with growth coupled to UbiB function

    • Screen for compounds that phenocopy ubiB deletion effects

    • Readout options:

      • Fluorescent ubiquinone analogs for direct pathway monitoring

      • Membrane potential sensors as indirect functional indicators

      • Growth inhibition under conditions requiring ubiquinone

  • Biochemical Activity Assays:

    • Establish robust assays measuring UbiB's ATPase activity

    • Implement in 384 or 1536-well format for high-throughput screening

    • Include counterscreens against human homologs to ensure selectivity

  • Target-Based NMR Screening:

    • Use ¹H-¹⁵N HSQC to monitor compound binding to isotopically labeled UbiB domains

    • Identify chemical shifts indicating specific binding interactions

    • Advantage: Provides structural information about binding mode

Selectivity Optimization Strategy:

To achieve selective inhibition of pathogenic E. coli UbiB while sparing beneficial bacteria and host cells:

  • Exploit Structural Differences:

    • Target regions that differ between pathogenic and commensal E. coli strains

    • Focus on accessibility differences due to membrane composition variations

    • Design compounds with limited penetration into mammalian cells

  • Prodrug Approaches:

    • Develop inhibitors activated by enzymes specific to pathogenic E. coli

    • Utilize outer membrane transporters unique to pathogenic strains

    • Example strategy: Siderophore-conjugated inhibitors targeting iron-acquisition systems

  • Combination Approaches:

    • Pair moderate UbiB inhibitors with compounds targeting virulence factors

    • Explore synergies with existing antibiotics at sub-MIC concentrations

    • Rationale: Pathway sensitization rather than complete inhibition

Expected Challenges and Mitigation Strategies:

ChallengeMitigation Approach
Membrane protein target accessibilityFocus on cytoplasmic domains or develop membrane-permeable compounds
Selectivity over human homologsExploit differences in ATP-binding site architecture
Pharmacokinetic optimizationEmploy nanoparticle delivery systems for targeted release
Resistance developmentTarget conserved residues essential for function

This multi-faceted approach to UbiB inhibitor development could yield novel antimicrobials targeting E. coli O157:H7 while addressing concerns about antibiotic resistance and HUS development associated with conventional antibiotics .

How might CRISPR-Cas technology be leveraged for studying UbiB function and developing novel therapeutics?

CRISPR-Cas technology offers unprecedented precision for investigating UbiB function and developing novel therapeutic strategies against pathogenic E. coli O157:H7. The following methodological framework outlines advanced applications of this technology for both basic science and translational research:

Precise Genetic Manipulation Strategies:

  • Domain-Specific Functional Analysis:

    • Generate precise in-frame deletions targeting specific UbiB domains

    • Create point mutations in catalytic residues to dissect biochemical function

    • Engineer domain swaps between UbiB and related proteins to identify functional regions

    • Technical refinement: Use base editors for scarless single nucleotide modifications

  • Regulatable Expression Systems:

    • Implement CRISPRi for tunable repression of ubiB expression

    • Deploy CRISPRa to upregulate ubiB in specific conditions

    • Create synthetic regulatory circuits responsive to environmental signals

    • Application: Study dosage effects and threshold requirements for UbiB function

  • High-Throughput Functional Genomics:

    • Conduct saturating mutagenesis of ubiB using CRISPR-Cas9 libraries

    • Implement multiplex CRISPR screening to identify genetic interactions

    • Perform parallelized reporter assays to map regulatory elements

    • Data analysis: Apply deep learning approaches to extract functional patterns

Advanced Methodological Approaches:

CRISPR ApplicationTechnical ImplementationResearch Value
Prime editingEngineer precise mutations without double-strand breaksStudy subtle structural effects without stress response activation
Base editingTargeted C→T or A→G substitutionsCreate catalytic dead mutants while maintaining protein structure
CRISPR activationdCas9-VP64 fusion targeting ubiB promoterStudy effects of UbiB overexpression
CRISPR interferencedCas9-KRAB repression of ubiBModel partial inhibition similar to therapeutic targeting
CRISPR imagingdCas9-fluorescent protein fusionsTrack UbiB localization and dynamics in living cells

Therapeutic Development Applications:

  • CRISPR-Based Antimicrobials:

    • Design CRISPR-Cas delivery systems targeting ubiB and related essential genes

    • Develop phage-delivered CRISPR systems with specificity for E. coli O157:H7

    • Engineer self-limiting CRISPR systems to prevent ecological disruption

    • Delivery vehicles: Engineered bacteriophages or conjugative plasmids

  • CRISPR Screening for Inhibitor Development:

    • Identify synthetic lethal interactions with ubiB for multi-target therapy

    • Screen for genetic suppressors of UbiB deficiency to predict resistance mechanisms

    • Map the genetic interaction network to identify collateral sensitivities

    • Advantage: Rational design of combination therapies with reduced resistance potential

  • Engineered Probiotics:

    • Develop CRISPR-engineered commensal bacteria that compete with pathogenic strains

    • Create sentinel strains with CRISPR-based detection and response systems

    • Generate protective strains producing anti-UbiB compounds upon pathogen detection

    • Approach: Circuit design linking detection to targeted response

Implementation Challenges and Solutions:

  • Delivery to Intestinal Pathogens:

    • Develop acid-resistant encapsulation for oral delivery

    • Engineer bacteriophage vectors with enhanced stability

    • Optimize conjugative delivery systems from commensal bacteria

  • Specificity for Pathogenic Strains:

    • Target sequences unique to O157:H7 serotype

    • Design guides recognizing virulence-associated regions

    • Implement AND-gate logic requiring multiple target recognition

  • Regulatory and Safety Considerations:

    • Incorporate self-limiting mechanisms to prevent environmental spread

    • Design kill-switches responsive to specific signals

    • Develop containment strategies with redundant safety mechanisms

By leveraging these advanced CRISPR-Cas approaches, researchers can gain unprecedented insights into UbiB function while developing novel therapeutic strategies that could overcome the limitations of conventional antibiotics in treating E. coli O157:H7 infections.

What unexplored aspects of UbiB function warrant investigation to advance our understanding of bacterial metabolism?

Despite significant progress in understanding ubiquinone biosynthesis, several unexplored aspects of UbiB function remain critical gaps in our knowledge of bacterial metabolism. The following research directions represent high-priority areas that could yield transformative insights:

Regulatory Network Integration:

  • Post-Translational Modification Landscape:

    • Map comprehensive phosphorylation, acetylation, and other modifications of UbiB

    • Identify modification enzymes and their regulatory inputs

    • Determine how modifications alter UbiB activity and interactions

    • Open question: Do modifications create condition-specific protein interaction networks?

  • Small Molecule Regulation:

    • Investigate allosteric regulation by metabolic intermediates

    • Examine the impact of membrane lipid composition on UbiB activity

    • Assess the influence of cellular redox state on UbiB function

    • Methodological approach: Implement metabolic flux analysis with stable isotope labeling

  • Integration with Global Regulatory Systems:

    • Map connections to oxygen-sensing regulatory networks

    • Characterize links between UbiB and stringent response pathways

    • Explore potential regulation by small regulatory RNAs

    • Novel hypothesis: UbiB may function as a metabolic checkpoint in stress responses

Structural-Functional Relationships:

  • Dynamic Conformational Changes:

    • Utilize hydrogen-deuterium exchange mass spectrometry to map conformational dynamics

    • Implement single-molecule FRET to observe real-time structural transitions

    • Develop conformation-specific nanobodies as research tools

    • Key question: Does UbiB undergo significant conformational changes during catalytic cycles?

  • Membrane Microdomain Association:

    • Investigate potential association with bacterial membrane microdomains

    • Determine lipid preferences and effects on activity

    • Map the precise topology and membrane insertion mechanism

    • Experimental approach: Native nanodiscs with defined lipid composition

  • Structural Basis of Pathway Adaptation:

    • Compare structural features between aerobic and facultative anaerobic species

    • Identify evolutionary adaptations in UbiB structure related to ecological niches

    • Determine if UbiB undergoes condition-dependent oligomerization

    • Computational approach: Evolutionary covariance analysis to identify co-evolving residues

Novel Functional Hypotheses:

Unexplored FunctionSupporting EvidenceInvestigation Approach
Oxygen sensing capabilityAltered activity under varying O₂ conditionsPurified protein assays with controlled O₂ levels
Membrane stress response roleExpression changes during membrane perturbationArtificial membrane stress induction and UbiB monitoring
Moonlighting function in DNA damage responsePutative interactions with DNA repair proteinsCo-immunoprecipitation and functional assays
Involvement in biofilm formationAltered biofilm phenotypes in ubiB mutantsSingle-cell tracking in developing biofilms
Horizontal gene transfer regulationPhylogenetic distribution patternsConjugation and transformation efficiency studies

Integrative Systems Biology Approaches:

  • Multi-Omics Integration:

    • Combine transcriptomics, proteomics, metabolomics, and fluxomics data

    • Develop predictive models of UbiB's role in metabolic network

    • Use machine learning to identify non-obvious regulatory relationships

    • Goal: Create a comprehensive model of UbiB's integration in bacterial physiology

  • Host-Pathogen Interface:

    • Investigate UbiB's role during host colonization

    • Determine if host immune responses target UbiB function

    • Explore how host-derived signals influence UbiB activity

    • Approach: Tissue-specific RNA-seq during infection to identify context-dependent regulation

  • Ecological and Environmental Dimensions:

    • Study UbiB function across environmental isolates

    • Investigate adaptations to specific ecological niches

    • Examine how UbiB contributes to survival in diverse environments

    • Novel perspective: UbiB as an environmental adaptation factor

These unexplored aspects of UbiB function represent promising research directions that could transform our understanding of bacterial metabolism and provide new insights into E. coli O157:H7 pathogenesis. By addressing these knowledge gaps, researchers can develop a more comprehensive model of ubiquinone biosynthesis regulation and its integration with broader cellular processes across environmental conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.