Recombinant Escherichia coli O157:H7 Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics

Structure:

  • Comprises seven transmembrane segments with N-terminus facing the periplasm and C-terminus oriented toward the cytoplasm .

  • Contains a conserved "Lgt signature motif" (residues Y26, N146, G154) essential for catalytic activity .

Catalytic Mechanism:

  • Transfers diacylglyceryl groups via a thioether bond formation .

  • Releases glycerol phosphate (G1P or G3P) as a byproduct during substrate modification .

Functional Role in Bacterial Physiology

Essentiality:

  • Indispensable for bacterial viability: Depletion causes outer membrane destabilization, increased antibiotic sensitivity, and serum susceptibility .

  • Critical for maintaining peptidoglycan (PG)-lipoprotein covalent linkages via Lpp (major outer membrane lipoprotein) .

Phenotypic Consequences of Lgt Inhibition:

ParameterEffect of Lgt Depletion/Inhibition
Outer membrane integrityCompromised (↑ OM permeability)
Antibiotic susceptibilityEnhanced (e.g., ↑ sensitivity to vancomycin)
VirulenceAttenuated in in vivo infection models

Enzymatic Activity Assays

  • IC₅₀ Values for Lgt Inhibitors:

    CompoundIC₅₀ (μM)Target Specificity
    G90660.24Lgt biochemical activity
    G28230.93Lgt-dependent growth inhibition
    G28240.18Bactericidal against E. coli and A. baumannii
  • Substrate Specificity:
    Requires a conserved cysteine residue in prolipoproteins (e.g., Pal lipoprotein-derived peptides) . Mutating this cysteine to alanine abolishes enzymatic activity .

Therapeutic Implications

Antibacterial Target Validation:

  • Lgt inhibitors (Lgti) exhibit bactericidal activity without cross-resistance to existing antibiotics .

  • Unlike downstream lipoprotein pathway inhibitors (e.g., LspA or LolCDE), Lgti efficacy is unaffected by lpp deletion, avoiding a common resistance mechanism .

Mechanistic Advantages:

  • Disrupts early lipoprotein maturation, causing accumulation of unmodified pro-Lpp and lethal outer membrane defects .

  • No reported on-target resistance mutations, likely due to conserved active-site binding .

Research Challenges and Future Directions

  • Mechanistic Gaps:
    Exact molecular interactions between Lgti and the phosphatidylglycerol/prolipoprotein binding sites remain unresolved .

  • Translational Barriers:
    Moderate activity against wild-type strains necessitates optimization for clinical use .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes, and we will prepare it accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery information.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please inform us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein with deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference point.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; ECH74115_4094; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPEFDPVIFSIGPVALHWYGLMYLVGFIFAMWLATRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPQFMADPLYLFRVWDGGMSFHGGLIGVIVVMIIFARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPNFPFAMLFPGSRTEDILLLQTN PQWQSIFDTYGVLPRHPSQLYELLLEGVVLFIILNLYIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIVAGVIMMVWAYRRSPQQHVS
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Lgt and what role does it play in E. coli O157:H7?

Lgt (Prolipoprotein diacylglyceryl transferase) catalyzes the first essential step in the biogenesis of Gram-negative bacterial lipoproteins. In E. coli O157:H7, Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to a conserved cysteine residue in preprolipoprotein substrates via formation of a thioether bond . This modification is crucial for bacterial growth, outer membrane integrity, and pathogenesis. The E. coli O157:H7 Lgt protein consists of 291 amino acids and contains multiple transmembrane domains that anchor it in the inner membrane where it performs its catalytic function .

How does Lgt function in the bacterial lipoprotein maturation pathway?

Lgt functions as the first enzyme in a three-step sequential process of lipoprotein maturation:

  • Lgt transfers the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the conserved cysteine in the lipobox motif of preprolipoproteins

  • Lipoprotein signal peptidase (LspA) subsequently cleaves the signal peptide

  • Apolipoprotein N-acyltransferase (Lnt) adds a third fatty acid to the amino group of the modified cysteine

Following these modifications, mature lipoproteins are transported to the outer membrane by the Lol transport system (LolCDE) . The coordinated action of these enzymes ensures proper lipoprotein maturation and localization, which is essential for maintaining outer membrane integrity in Gram-negative bacteria .

Why is Lgt considered a promising target for antibacterial development?

Lgt represents a compelling antibacterial target for several reasons:

  • Essential function: Lgt depletion is lethal to pathogenic E. coli strains, including uropathogenic clinical isolates

  • Modest inhibition is effective: Even partial depletion (~25%) of Lgt is sufficient for bactericidal activity, suggesting that incomplete inhibition by therapeutic agents could be clinically effective

  • Membrane destabilization: Lgt inhibition leads to outer membrane permeabilization, increasing bacterial sensitivity to serum killing and antibiotics

  • Resistance profile: Unlike inhibitors of other steps in lipoprotein biosynthesis, resistance to Lgt inhibition cannot be achieved through deletion of the major outer membrane lipoprotein (lpp)

  • Conservation: Lgt is highly conserved across Gram-negative bacteria, suggesting broad-spectrum potential

Research has demonstrated that Lgt depletion results in significant attenuation in a mouse E. coli bacteremic infection model, further supporting its potential as a therapeutic target .

Experimental Approaches

Lgt enzymatic activity can be measured through several biochemical approaches:

  • Glycerol phosphate release assay: This method measures the release of glycerol phosphate, a by-product of the Lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate. The assay employs:

    • A peptide substrate derived from the Pal lipoprotein (Pal-IAAC, where C is the conserved cysteine modified by Lgt)

    • Detection of glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) released during the reaction

    • A coupled luciferase reaction for sensitive quantification

  • Control validations: Negative controls using mutant Pal peptide substrate with the conserved cysteine mutated to alanine (Pal-IAA) can confirm assay specificity

This assay system has been instrumental in identifying and characterizing Lgt inhibitors with IC50 values in the sub-micromolar range (0.18-0.93 μM) .

What methods can detect different forms of lipoproteins after Lgt inhibition?

Several analytical methods can detect and differentiate lipoprotein forms resulting from Lgt inhibition:

  • SDS fractionation and Western blot analysis:

    • Separation of SDS-insoluble peptidoglycan-associated proteins (PAP) from SDS-soluble non-PAP

    • Detection of various Lpp forms using specific antibodies

    • Identification of distinct migration patterns for different Lpp forms:

      • Unmodified pro-Lpp (UPLP): Accumulates after Lgt depletion

      • Diacylglyceryl-modified pro-Lpp (DGPLP): Accumulates after LspA depletion

      • Triacylated mature Lpp: Found in normal conditions

      • PG-linked Lpp forms: Enriched in PAP fraction

  • Lysozyme treatment:

    • Addition of lysozyme allows identification of peptidoglycan-linked Lpp forms

    • Enhances detection sensitivity for specific Lpp modifications

These methods have been used to confirm that specific depletion of Lgt leads to accumulation of unmodified pro-Lpp, consistent with blockade of the first step in lipoprotein processing .

How does partial inhibition of Lgt affect bacterial cell physiology?

Partial inhibition of Lgt has profound effects on bacterial physiology, even when complete growth inhibition is not achieved:

  • Membrane permeability changes: E. coli cells expressing as high as ~90% of normal Lgt levels show significantly increased incorporation of SYTOX Green, a dye that normally does not penetrate an intact outer membrane

  • Serum sensitivity: Modest depletion of Lgt leads to increased sensitivity to complement-mediated killing, even in typically serum-resistant strains like E. coli CFT073

  • Antibiotic susceptibility: Partial Lgt depletion that still allows normal growth in vitro results in increased sensitivity to antibiotics normally excluded by the impermeable Gram-negative outer membrane

  • Morphological changes:

    • Increased cell size

    • Inner membrane contraction due to osmotic stress (Lpp-dependent)

    • Altered cellular ultrastructure

These findings suggest that even sub-lethal inhibition of Lgt could potentiate conventional antibiotics or host defense mechanisms, potentially offering advantages for therapeutic applications .

Why doesn't lpp deletion rescue growth after Lgt depletion, unlike with other lipoprotein biosynthesis inhibitors?

A key distinction between Lgt inhibition and inhibition of downstream lipoprotein processing enzymes lies in the lpp-independence of Lgt's essential function:

  • Downstream inhibitors: Inhibition of LspA (the second enzyme in lipoprotein processing) or disruption of the Lol transport system can be rescued by deletion of lpp, suggesting that accumulation of toxic Lpp intermediates is the primary cause of lethality

  • Lgt inhibition: Deletion of lpp is not sufficient to rescue growth after Lgt depletion or provide resistance to Lgt inhibitors

  • Mechanistic implications: This suggests that Lgt's essential function extends beyond processing Lpp and likely involves multiple essential lipoproteins. The lethality associated with Lgt inhibition appears to result from global disruption of lipoprotein processing rather than toxic accumulation of a single intermediate

This mechanistic distinction has significant implications for antimicrobial development, as it suggests that Lgt inhibitors may be less susceptible to one of the most common resistance mechanisms that invalidate inhibitors of downstream steps in bacterial lipoprotein biosynthesis and transport .

What approaches have been used to identify and validate Lgt inhibitors?

The identification and validation of Lgt inhibitors has employed multiple complementary approaches:

  • Initial discovery:

    • Screening for compounds that bind to purified Lgt protein

    • Biochemical assays measuring inhibition of enzymatic activity in vitro

  • Validation of target engagement:

    • Comparison of phenotypes between inhibitor treatment and genetic depletion

    • Western blot detection of accumulated unmodified pro-Lpp after treatment

    • Measurement of outer membrane permeabilization using dye uptake assays

  • Specificity confirmation:

    • Testing inhibitor activity in strains with reduced Lgt expression

    • Evaluating cross-species activity with Lgt proteins of varying sequence identity

    • Examining resistance mechanisms and attempting to generate resistant mutants

Notable Lgt inhibitors identified include compounds G9066, G2823, and G2824, which potently inhibit Lgt biochemical activity (IC50 values of 0.24 μM, 0.93 μM, and 0.18 μM, respectively) and demonstrate bactericidal activity against wild-type E. coli and A. baumannii strains .

What are the structural and functional characteristics of E. coli O157:H7 Lgt protein?

The E. coli O157:H7 Lgt protein possesses several key structural and functional characteristics:

  • Protein structure:

    • 291 amino acid polypeptide

    • Multiple transmembrane domains creating a hydrophobic binding pocket

    • Conserved catalytic residues critical for enzymatic function

  • Conservation: Significant sequence conservation exists among Lgt proteins from various bacterial species, with E. coli Lgt sharing 51.6% sequence identity with P. aeruginosa PA14 Lgt and 48.6% with A. baumannii ATCC 17978 Lgt

  • Substrate specificity: Recognizes and modifies preprolipoproteins containing a conserved "lipobox" motif with a cysteine residue that becomes the N-terminal residue of the mature lipoprotein

This detailed structural and functional information provides a foundation for structure-based inhibitor design and rational modification of existing inhibitors .

How can one generate and validate conditional Lgt mutants in E. coli?

Generation of conditional Lgt mutants requires careful genetic manipulation due to Lgt's essential nature:

  • Construction of arabinose-inducible system:

    • Replace the native lgt promoter with the arabinose-inducible araBAD promoter

    • Retain the lgt stop codon, which forms part of the thyA ribosomal binding site

    • Confirm that thyA expression remains unchanged to prevent polar effects

  • Validation steps:

    • Verify arabinose-dependent growth

    • Demonstrate complementation with plasmid-encoded lgt

    • Confirm depletion of Lgt protein using western blot analysis

    • Verify accumulation of unprocessed lipoproteins upon Lgt depletion

  • Critical considerations:

    • Monitor thyA expression levels, as thyA is downstream of lgt and its ribosome binding site overlaps with the lgt stop codon

    • Ensure tight control of the inducible promoter to prevent leaky expression

    • Account for the time required for existing Lgt depletion when removing the inducer

This approach has been successfully implemented in both laboratory and clinical isolates of E. coli, including the uropathogenic E. coli strain CFT073 .

What controls are essential when studying Lgt inhibition?

Robust experimental design for studying Lgt inhibition requires several critical controls:

  • Genetic controls:

    • Inducible lgt deletion strains as positive controls for Lgt inhibition

    • Complemented strains expressing heterologous lgt genes to confirm specificity

    • Parallel studies with inducible deletion strains for other lipoprotein processing enzymes (lspA, lnt, lolCDE) to distinguish pathway-specific effects

  • Biochemical assay controls:

    • Mutant peptide substrates (e.g., Pal-IAA with cysteine-to-alanine substitution)

    • Enzyme concentration controls and time-course experiments

    • Verification of substrate quality and reaction conditions

  • Target engagement controls:

    • Western blot analysis to confirm accumulation of unmodified pro-Lpp

    • Comparison of phenotypes between inhibitor treatment and genetic depletion

    • Cross-resistance testing with other membrane-targeting agents

Implementation of these controls ensures reliable interpretation of results and clear differentiation between Lgt-specific effects and general membrane perturbations or off-target activities .

What phenotypic assays best demonstrate successful Lgt inhibition?

Several phenotypic assays effectively demonstrate successful Lgt inhibition:

  • Membrane permeability assays:

    • SYTOX Green incorporation: Measures outer membrane permeabilization

    • Susceptibility to normally excluded antibiotics: Quantifies permeability changes

  • Lipoprotein processing analysis:

    • Western blot detection of accumulated unmodified pro-Lpp

    • SDS fractionation to separate peptidoglycan-associated proteins

  • Physiological consequences:

    • Microscopy for cell size and morphology changes

    • Serum sensitivity assays to assess complement resistance

    • In vivo infection models to evaluate attenuation

  • Comparative metrics:

    • Quantitative comparison with genetic depletion phenotypes

    • Dose-dependent relationships between inhibition and phenotypic outcomes

The most convincing demonstration of Lgt inhibition combines biochemical evidence of target engagement with multiple phenotypic assays showing the expected spectrum of cellular consequences .

How can researchers differentiate between on-target and off-target effects of potential Lgt inhibitors?

Differentiating between on-target and off-target effects requires a multi-faceted approach:

  • Biochemical confirmation:

    • Demonstration of direct Lgt enzyme inhibition in vitro

    • Structure-activity relationship studies correlating biochemical potency with cellular effects

  • Genetic validation:

    • Testing in strains with reduced Lgt expression, which should show increased sensitivity to on-target inhibitors

    • Comparison of phenotypic profiles between inhibitor treatment and genetic Lgt depletion

  • Specificity indicators:

    • Accumulation of the expected lipoprotein intermediate (unmodified pro-Lpp)

    • Lack of effect on other cellular processes at concentrations that inhibit Lgt

    • Conservation of activity across Lgt orthologs with significant sequence divergence

  • Resistance studies:

    • Attempts to generate on-target resistant mutants (though the essential nature of Lgt may make this challenging)

    • Evaluation of potential resistance mechanisms

Research has shown that true Lgt inhibitors produce phenotypic signatures closely matching those observed with genetic Lgt depletion, including specific accumulation of unmodified pro-Lpp, outer membrane permeabilization, and increased antibiotic susceptibility .

What are the major challenges in developing potent and selective Lgt inhibitors?

Several challenges complicate the development of potent and selective Lgt inhibitors:

  • Structural complexity: The membrane-embedded nature of Lgt creates difficulties for structural studies and rational inhibitor design

  • Substrate binding sites: The current limited understanding of how inhibitors compete with either phosphatidylglycerol or prolipoprotein substrates hampers optimization efforts

  • Resistance concerns: Although Lgt inhibitors may avoid common resistance mechanisms affecting other lipoprotein processing inhibitors, novel resistance mechanisms could potentially emerge

  • Permeability barriers: The Gram-negative outer membrane presents permeability challenges for inhibitor entry, particularly for compounds targeting an inner membrane enzyme

  • Selectivity issues: Ensuring selectivity against mammalian enzymes that process lipid-modified proteins presents another challenge for therapeutic development

Despite these challenges, the identification of the first Lgt inhibitors with sub-micromolar potency represents significant progress in this field .

How might Lgt inhibition be combined with other therapeutic approaches?

The unique mechanism of Lgt inhibition suggests several promising combinatorial approaches:

  • Antibiotic potentiation:

    • Partial Lgt inhibition increases bacterial susceptibility to antibiotics normally excluded by the outer membrane

    • Combined therapy could reduce required antibiotic doses and expand the spectrum of effective antibiotics

  • Immune potentiation:

    • Lgt inhibition increases bacterial sensitivity to serum killing

    • Combination with immune-stimulating agents could enhance clearance of Gram-negative infections

  • Multi-target approaches:

    • Simultaneous inhibition of multiple steps in lipoprotein processing might create synergistic effects

    • Targeting both lipoprotein processing and other essential pathways could reduce resistance development

  • Species-specific optimization:

    • Despite conservation, sequence differences in Lgt across bacterial species offer opportunities for pathogen-specific inhibitors

    • Tailored combinations could address specific infection scenarios

The observed bactericidal activity of Lgt inhibitors against wild-type strains of both E. coli and A. baumannii underscores the potential broad-spectrum applications of this approach .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.